Script language problem in Address syntax

For this syntax in script
ADDRESS PARAGRAPH ZD LINES 8
NAME     &BILL_NAME1&, &BILL_NAME2&, &BILL_NAME3&, &BILL_NAME4&
STREET   &BILL_STRAS&
POBOX    &BILL_PFACH& CODE &BILL_PSTL2& CITY &BILL_PFORT&
POSTCODE &BILL_PSTLZ&
REGION   &BILL_REGIO&
CITY     &BILL_ORT01&
COUNTRY &BILL_LAND1&
ENDADDRESS
Output I got is:
Pvt ltd
Postfach 123
111 KUWAIT
KUWAIT
But I need output in this format: po box must be written in English
Pvt ltd
PO BOX 123
111 KUWAIT
KUWAIT

What happens if you try to login in English Language and try to print it?
I looked into the FM ADDRESS_INTO_PRINTFORM and I found that "PO Box" is being maintained in the Text elements of that function group. So, if you try to generate the output by logging in English, it should generate the PO Box in the address.
Regards,
Naimesh Patel

Similar Messages

Script language problem

Hi friends,
We designed a script for purchase order for taiwans, and it is
displaying the incorrect Payment Terms when outputted (e.g. printed) using the ZEBT(own outtype) output type in language 'ZF'. The Payment Terms text displayed in the ouputted form is not the correct text for the Payment Term on the Purchase Order.
and it is displaying correct when the outtype in language 'EN'.
can any suggest me on this, how it is happening.
Thanks.

HI friend..
I have faced the same problem very long ago..
Try to debug the script first in se71.
At the main window look for the field netwr....
Just do some checking there..
Otherwise i can think for u some other solution...
regards..
saravannan...

Problem in address printing in sap script in Russian language

hi all
I am trying to get a PO output using a sap script. The problem is that the vendor address in not coming in the required Russian language. The language in PO is Russian and the logon langauge is also Russian.
The script uses ADDRESS ENDADDRESS statement to print the address in form. This statement
uses the function module ADDRESS_INTO_PRINTFORM to print the address. The address can be obtained in the required language from this function module but I want the address in Russian language uses the ADDRESS ENDADDRESS statement.
Please let me know if any body has faced this kind of problem earlier.
Thanks.

Hi,
pls check that u have provided the following parameters in ADDRESS ENDADDRESS.
/:address
/:COUNTRY recipient country [language code]
/: COUNTRY_IN_REC_LANG
/: LANG_FOR_COUNTRY language key
/:endaddress
language codes can be know in table T002.
Hopes this helps!!
thanks

Coding Problem 6 Now Defined in Scripting Languages/Bioinformatics WIKI

In the "Scripting Languages and Bioinformatics" WIKI, I have completed a new page here:
https://wiki.sdn.sap.com/wiki/display/EmTech/Bio-InformaticBasicsPartII-AlignmentToolsforRelatingProteinGenestoProteinPrimaryStructures
and also defined Coding Problem 6 at the end of this page.
This problem involves scripting an interactive session with a web site and parsing what the web site returns at various points duing the session.
Am looking foward to a script that solves this problem, if anyone feels like spending the time to do it.

<?
// sequence to search ---------------------------------------------
$bquery      = "MTQIIKIDPLNPEIDKIKIAADVIRNGGTVAFPTETVYGLGANAFDG";
$bquery     .= "NACLKIFQAKNRPVDNPLIVHIADFNQLFEVAKDIPDKVLEIAQIVW";
$bquery     .= "PGPLTFVLKKTERVPKEVTAGLDTVAVRMPAHPIALQLIRESGVPIA";
$bquery     .= "APSANLATRPSPTKAEDVIVDLNGRVDVIIDGGHTFFGVESTIINVT";
$bquery     .= "VEPPVLLRPGPFTIEELKKLFGEIVIPEFAQGKKEAEIALAPGMKYK";
$bquery     .= "HYAPNTRLLLVENRNIFKDVVSLLSKKYKVALLIPKELSKEFEGLQQ";
$bquery     .= "IILGSDENLYEVARNLFDSFRELDKLNVDLGIMIGFPERGIGFAIMN";
$bquery     .= "RARKASGFSIIKAISDVYKYVNI";
// url for form1 --------------------------------------------------
$url = "http://blast.ncbi.nlm.nih.gov:80/Blast.cgi";
// parameters for form1 -------------------------------------------
$bdb         = "protein";
$bgeneticcode= "1";
$bquery_from = "";
$bquery_to   = "";
$bjobtitle   = "ACW-" . time();
$bdatabase   = "nr";
$bblastprog = "tblastn";
$bpagetype   = "BlastSearch";
$pf = "";
$pf .= "QUERY=" . $bquery;
$pf .= "&db=" . $bdb;
$pf .= "&QUERY_FROM=" . $bquery_from;
$pf .= "&QUERY_TO=" . $bquery_to;
$pf .= "&JOB_TITLE=" . $bjobtitle;
$pf .= "&DATABASE=" . $bdatabase;
$pf .= "&BLAST_PROGRAMS=" . $bblastprog;
$pf .= "&PAGE_TYPE=" . $bpagetype;
$pf .= "&GENETIC_CODE=1";
$pf .= "&DBTYPE=";
$pf .= "&EQ_MENU=";
$pf .= "&EQ_TEXT=";
$pf .= "&NEWWIN=";
$pf .= "&MATCH_SCORES=";
$pf .= "&MAX_NUM_SEQ=100";
$pf .= "&EXPECT=10";
$pf .= "&WORD_SIZE=3";
$pf .= "&MATRIX_NAME=BLOSUM62";
$pf .= "&GAPCOSTS=11 1";
$pf .= "&COMPOSITION_BASED_STATISTICS=2";
$pf .= "&REPEATS=";
$pf .= "&FILTER=";
$pf .= "&LCASE_MASK=";
$pf .= "&TEMPLATE_LENGTH=";
$pf .= "&TEMPLATE_TYPE=";
$pf .= "&I_THRESH=0.005";
$pf .= "&CLIENT=web";
$pf .= "&SERVICE=plain";
$pf .= "&CMD=request";
$pf .= "&PAGE=Translations";
$pf .= "&PROGRAM=tblastn";
$pf .= "&MEGABLAST=";
$pf .= "&RUN_PSIBLAST=";
$pf .= "&SELECTED_PROG_TYPE=tblastn";
$pf .= "&SAVED_SEARCH=true";
$pf .= "&BLAST_SPEC=";
$pf .= "&QUERY_BELIEVE_DEFLINE=";
$pf .= "&DB_DIR_PREFIX=";
$pf .= "&SHOW_OVERVIEW=true";
$pf .= "&SHOW_LINKOUT=true";
$pf .= "&GET_SEQUENCE=true";
$pf .= "&FORMAT_OBJECT=Alignment";
$pf .= "&FORMAT_TYPE=HTML";
$pf .= "&ALIGNMENT_VIEW=Pairwise";
$pf .= "&MASK_CHAR=2";
$pf .= "&MASK_COLOR=1";
$pf .= "&DESCRIPTIONS=100";
$pf .= "&ALIGNMENTS=100";
$pf .= "&NEW_VIEW=true";
$pf .= "&OLD_BLAST=true";
$pf .= "&NCBI_GI=false";
$pf .= "&SHOW_CDS_FEATURE=false";
$pf .= "&NUM_OVERVIEW=100";
$pf .= "&FORMAT_EQ_TEXT=";
$pf .= "&FORMAT_ORGANISM=";
$pf .= "&EXPECT_LOW=";
$pf .= "&EXPECT_HIGH=true";
$pf .= "&QUERY_INDEX=0";
// define the HTTP connection -----------------------------
$ch = curl_init();
curl_setopt($ch,CURLOPT_URL,$url);
curl_setopt($ch, CURLOPT_POST, 1);
curl_setopt($ch,CURLOPT_POSTFIELDS, $pf);
curl_setopt($ch,CURLOPT_COOKIEJAR,
dirname(__FILE__).'/cookie.txt');
curl_setopt($ch,CURLOPT_FOLLOWLOCATION,1);
curl_setopt($ch, CURLOPT_HEADER , 1);
curl_setopt($ch, CURLOPT_RETURNTRANSFER,1);
// call it ------------------------------------------------
$my_result = curl_exec($ch);
// get the request ID; the query takes some time and this ID
// allows to identify the original request
$query = "/<tr><td>Request ID<\/td><td> <b>([0-9A-Z]*)<\/b><\/td><\/tr>/";
preg_match($query, $my_result, $request_id);
// query for the result page every 2 seconds...when the result
// is ready, we recognize it by its signature
$not_ready = true;
$result_url = "http://blast.ncbi.nlm.nih.gov/Blast.cgi?CMD=Get&VIEW_RESULTS=FromRes&RID=" . $request_id[1];
while($not_ready){
$temp_page = null;
curl_setopt($ch,CURLOPT_URL,$result_url);
curl_setopt($ch, CURLOPT_POST, 0);
$my_result = curl_exec($ch);
$query = "/This page will be automatically updated in <b>(\d*)<\/b> seconds/";
preg_match($query, $my_result, $temp_page);
if(isset($temp_page[1])) { sleep(2); }
else { $not_ready = false; }
// parse the results page; split it into result fragments first --------
$pat = "/";
$pat .= "><input type=\"checkbox\" name=\"getSeqGi\"([^\n]*)\n";
$pat .= "Length=\d*\n\n";
$pat .= "[\w\s]*:\n";
$pat .= "(\s*<a[^>]*>[^<]*<\/a>\n)*\n";
$pat .= "([^\n]*\n){3}\n";
$pat .= "(([^\n]*\n){3}\n[^n])*";
$pat .= "/";
preg_match_all($pat, $my_result, $fragments);
// 'fine parse the result fragments and get some important parameters -----
foreach($fragments[0] as $fragment){
$query = "/<a href=\"http:\/\/(www\.ncbi\.nlm\.nih\.gov\/entrez\/query\.fcgi\?";
$query .= "[^>]*)>([^<]*)<\/a><a[^>]*>[^<]*<\/a>\s*<a[^>]*><img[^>]*><\/a>([^\n]*)/";
preg_match($query, $fragment, $u);
$query = "/\s*Score\s*=\s*(\d*) bits\s*$\d*$,\s*Expect\s*=\s*([^,]*),";
$query .= "[^\n]*\n\s*Identities\s*=\s*\d*\/\d*\s*$(\d*%)$[^\n]*\n\s*Frame\s*=\s*([^\n]*)\n/";
preg_match($query, $fragment, $u1);
preg_match_all("/Sbjct\s*(\d*)\s*[A-Z\-]*\s*(\d*)\n/", $fragment, $positions);
$fr["url"]        = $u[1];
$fr["shname"]     = $u[2];
$fr["name"]       = $u[3];
$fr["score"]      = $u1[1];
$fr["expect"]     = $u1[2];
$fr["identities"] = $u1[3];
$fr["frame"]      = $u1[4];
// find out if we have to reverse the strand direction or not; adjust
// lower and upper limit
if ($fr["frame"] >= 0) {
    $fr["high"] = $positions[2][count($positions)-1]; $fr["low"] = $positions[1][0]; $fr["reverse"] = ""; }
else {
    $fr["high"] = $positions[1][0]; $fr["low"] = $positions[2][count($positions)-1]; $fr["reverse"] = true;}
$frx[] = $fr;
// we call the final details form for the top ranked result
// here we could loop over several results
curl_setopt($ch,CURLOPT_URL,$frx[0]["url"]);
curl_setopt($ch, CURLOPT_POST, 0);
$my_result = curl_exec($ch);
// parse the final details form to get the necessary parameters to execute
// the final details form
preg_match("/<input name=\"WebEnv\" type=\"hidden\" value=\"([^\"]*)\"/",
           $my_result, $u5);
preg_match("/<input name=\"query_key\" type=\"hidden\" value=\"([^\"]*)\"/",
           $my_result, $u6);
preg_match("/<input name=\"db\" type=\"hidden\" value=\"([^\"]*)\"/",
           $my_result, $u7);
preg_match("/<input name=\"qty\" type=\"hidden\" value=\"([^\"]*)\"/",
           $my_result, $u8);
preg_match("/<input name=\"c_start\" type=\"hidden\" value=\"([^\"]*)\"/",
           $my_result, $u9);
preg_match(
"/<select name=\"dopt\".*<option value=\"([^\"]*)\" selected=\"1\">/",
$my_result, $u10);
preg_match(
"/<select name=\"dispmax\".*<option value=\"([^\"]*)\" selected=\"1\">/",
$my_result, $u11);
preg_match(
"/<select name=\"sendto\".*<option value=\"([^\"]*)\" selected=\"1\">/",
$my_result, $u12);
preg_match(
"/<input type=\"hidden\" id=\"([^\"]*)\" name=\"fmt_mask\".*value=\"([^\"]*)\"/",
$my_result, $u13);
preg_match(
"/<input type=\"checkbox\" id=\"truncate\" name=\"truncate\" value=\"([^\"]*)\"\/>/",
$my_result, $u14);
// fill in the necessary parameters parsed out now and earlier
$of = "WebEnv=" . $u5[1];
$of .= "&query_key=" . $u6[1];
$of .= "&db=" . $u7[1];
$of .= "&qty=" . $u8[1];
$of .= "&c_start=" . $u9[1];
$of .= "&dopt=" . $u10[1];
$of .= "&dispmax=" . $u11[1];
$of .= "&sendto=" . $u12[1];
$of .= "&fmt_mask=" . $u13[1];
$of .= "&truncate=" . $u14[1];
$of .= "&less_feat=";
$of .= "&from=" . $fr["low"];
$of .= "&to=" . $fr["high"];
$of .= "&strand=" . $fr["reverse"];
$of .= "&extrafeatpresent=1";
$of .= "&ef_SNP=1";
$of .= "&ef_CDD=8";
$of .= "&ef_MGC=16";
$of .= "&ef_HPRD=32";
$of .= "&ef_STS=64";
$of .= "&ef_tRNA=128";
$of .= "&ef_microRNA=256";
$of .= "&ef_Exon=512";
$of .= "&submit=Refresh";
$ourl = "http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?" . $of;
// execute the final details form
curl_setopt($ch,CURLOPT_URL,$ourl);
curl_setopt($ch, CURLOPT_POST, 0);
curl_setopt($ch,CURLOPT_POSTFIELDS, $of);
curl_setopt($ch,CURLOPT_FOLLOWLOCATION,1);
curl_setopt($ch, CURLOPT_HEADER , 1);
curl_setopt($ch, CURLOPT_RETURNTRANSFER,1);
$my_result = curl_exec($ch);
// parse the result page and get the final ORIGIN snippet
preg_match("/ORIGIN\s*\n\s*<a name=\"[^\"]*\"><\/a>\s*([^\/]*)\//", $my_result, $u99);
// output the final result ----------------------------------
echo "\n" . preg_replace("/\s{2,}/", "\n", preg_replace("/\d+\s/", "", $u99[1]));
?>
Edited by: Anton Wenzelhuemer on Aug 6, 2008 8:08 PM (Re-Formatted)

Problem in Address Endaddress statement in sapscript

Hello Friends,
I have 1 problem in existing sap script for delivery where address is printed using command address endaddress.
Problem is In output while displaying PO BOX text , it is displayed in DE language insted of EN whether logon lang is EN.
Regards,
Yog

Hi
To translate the text in SAP Script :
You can goto transaction SE63 and translate the scripts into different languages.
In SE63, click Translation -> Long Texts -> Sapscripts -> Forms
Those language you can convert to have already been pre-installed in the system.
SE63 is the best way to translate since it offers check options.
Or
Also try to change logon language to korea.
Hope this will solve your problem.
Rewards Points if useful.
Thanks & Regards
Nikunj Shah

Scripting Languages Tool Preview

Ok, this new thread is for posting about the Scripting Languages Tool Preview. Any comments, thoughts, ideas, contributions?
Greetings,
Blag.

John: as Frank said, we'd love to see generators for other languages - like JavaScript - in future. But we don't want to create them all alone. So here's the deal: we create the framework and some generators for the most widely-used languages and you cool guys on SDN build on that and create other generators, other viewers, anything you think is useful. And for all questions or problems we (SAP Scripting Team) will offer all the help we can. I'm very looking forward to see what will evolve from this
This works two-way. It's you who have year-long experience in all kind of scripting languages - combined it's much more knowledge than we can have. So when I face a scripting problem during generator-creation I'll just ask for your help here
Piers: no, it did not arrive. Please send again. I checked my profile and the mail-address was just not set to 'visible'. Your's isn't, too
About the 'integration': it is a clear goal to let it work inside other frameworks (Eclipse-based). As we do not have or use all of these I can just assume that it'll work just fine using the standard Eclipse mechanisms. Scripting in a Box is definitely a good candidate for this, and I myself use it for testing both tool integration and generated scripts.
Bundling - we thought about this, but there might be legal issues, so we have to wait for an official approval. Meanwhile it's not that complicated just getting SiaB and installing the tool afterwards
:Frederic:

SAP Scripting Languages on the SDN Day - Amsterdam

I would like to give a short summary of what happened on the SDN Day in Amsterdam, the 17-th Oct. 2006.
After the breakfast Craig Cmehil gave us a welcome to the event and presented the schedule. We started with a power networking session: Four 20-minute Sessions with Six SDNers per Table. As I was sitting at the Scripting Languages table, I would like to share some impressions of the atmosphere there. We talked much about the emmerging SAP Scripting Tool and how much value it will bring to all scripting projects that plan to utilize SAP backend systems. We discussed Gregor Wolf's contest and he was so kind to inform us that his test system is also available inside the SAP corporate network, so all SAP employees now can participate too. Gregor works for Siteco Beleuchtungstechnik GmbH and the award they offer for the contest is a Siteco Vistosa task light. More information about the contest can be found at https://www.sdn.sap.com/irj/sdn/weblogs?blog=/pub/wlg/4588. [original link is broken] [original link is broken] Another key discussion was held with Björn Schotte, the chief editor of PHP Magazine, Germany, presenting also his company Mayflower Gmbh. He shared some visions on business applications of PHP and stated that PHP is definitely enterprise ready.
Then after a very short pause we started the SDN breakout sessions (3-5 in parallel). I visited the sessions of Gregor Wolf, André Labahn, Björn Schotte and after this I cooperated for the breakout session of Frank Mittag.
Session 1:
Connecting Typo3 to R/3 Enterprise via Web Services with Gregor Wolf from Siteco Beleuchtungstechnik GmbH
Siteco Beleuchtungstechnik GmbH currently implements a customer service centre into it's Typo3 based website. Typo3 is an Open Source Web Content Management system based on the Scripting Language PHP. The application will allow Siteco's customers to directly check price & availability of products from the backend R/3 Enterprise system, quotations, orders and delivery status. The backend connectivity uses Web Services utilise the PEAR SOAP Package.
Session 2:
SAP supports Scripting Languages with Andre Labahn from SAP.
This session will provide you with more insights on how SAP is supporting scripting languages.
Session 3:
Scripting Languages PHP and Enterprise Software with Björn Schotte (Chief Editor from PHP Magazine).
This session showed us a brief history of PHP and PHP in Germany. Some enterprise applications of PHP were discussed. Björn Schotte was the opinion that PHP is definitely enterprise ready and he proved it with an example of a system that his company has created for Siemens.
Session 4:
Scripting Languages Tool with Frank Mittag and Vasil Bachvarov (me) from SAP
SAP will provide a open source tool to the scripting development community that is supporting the access to SAP Backend Systems via RFC/BAPIs and Webservices. See the concept and demo of the tool and discuss this with SAP Development.
There was a pretty interesting discussion about the tool. Since the time for the last session shrinked with some minutes we had to be very quick, but Frank Mittag did a great job and succeeded to explain the basic concept of the SAP Scripting Tool and show it in action for the tough time constraint.
There were a lot of questions from the audience but it was already 18:30 and we stopped at this point. There would be a second chance for questions on thursday when Frank had the opportunity to make a more complete and comprehensive walk-through of the project.
Then we gathered in the meeting hall and Shai Agassi held a speech and made a summary of the event.
The evening finished in the BoomChicago theater where everybody received a delicious meal, drinks and a great amount of fun with the ChicagoBoom comic crew.
I would like to thank all people that made this event come true! See you soon in Bangalore.
Best Regards,
Vasil Bachvarov
SAP AG

I'm be there in Amsterdam as well. In fact I am leaving the US on Sunday and arriving early Monday morning in Amsterdam.
I was planning to do a little site seeing on Monday Afternoon. If anyone else is arriving a bit early as well, they are welcome to join me. It is always more fun to site see in groups. My email address is public in my SDN business card (also not too difficult to figure out ) if anyone is interested in meeting up.

Looking for a more universal scripting language than AppleScript or Automator

I want to learn a cross-platform/web scripting language to automate tasks, write scripts and with the potential to create programs and web apps.
I am looking for something that:
- is not a program with a GUI like Automator, iKey, Quickeys, Maestro...
- is more "universal" than Applescript, cross-platform
- can be used to automate simple tasks in a simple way
- can also be used to create more complex scripts, web apps and maybe, eventually, programs (with GUI)
I've read about Javascript, Python, Ruby, PHP, Perl, C+, C++, Java and others, but I really don't know.
- Java sounds pretty cool, Python too.
- I'm not crazy about PHP or Perl, with Javascript, but some people swear by it
- I don't know anything about C+, C++
Does anyone have any suggestion(s)? Please let me know if you need any more details. Thank you.

C, C++, Objective-C are nor scripting languages and will not help you do web pages. (Don;t know what C+ is).
Forget Java it has lots of security problems and more and more users are disabling Java in their web browsers because of this. Developing in Java would be, in my opinion, a mistake.
If you are doing any web works at all you will need to know some Javascript, no way around that. But Javascript is actually not a bad language
Note Java and Javascript are two totally separate languages that have nothing in common but the first 4 letters of their names.
So you are left with PHP, Perl, Python and Ruby.
Dismissing PHP and Perl out of hand is a big mistake, They are both major players and you will run into them just about everywhere. If you are looking to do this for possible employment you will need to be familiar with them at least.
Python and Ruby are both strong languages as well. I don't have a lot of experience with either so I can;t speak to their strengths but learnign either would not be a mistake.
Knowing what your reasons are for asking this, personal use or for employment, might help refine the list some.
regards
Message was edited by: Frank Caggiano - Perl is also included in OS X by default. Not sure about PHP but I believe it also is. I agree TextWrangler would be a good editor for this type of work.

How to create a scripting language in java?

Hello,
All that I want to do is to create a scripting language in java. I�m familiar with javacc, jsr223 and other things but don�t know how to start. The language syntax is java 5 syntax with some change and I want to generate java source code from small scripts. In fact I don�t know how other languages (like groovy) are created.
I hope you can show me the required steps.
Looking forward to hear from you.
Thanks.

That's all, huh?
For a start, generally when I hear "scripting language" I'm thinking interpretter, not a system which creates compiled (or compilable) code.
I get the impression that what you're talking about is what I'd call a "preprocessor" language, some extra syntax added to java which the preprocessor renders into ordinary java.
As far as complexity is concerned, much depends on how deeply involved the extra syntax is with the embedded ordinary Java. Does you preprocessor need to understand the java, or is it just embedded as text? How easilly identified are your preprocesor statments? It's a lot easier to do this if preprocessor lines are instantly identifiable from Java code (e.g. start with a #).
Basically the stages are always the same;
1) Lexical analysis i.e. picking out words, operators, numbers, quoted strings.
2) Construct a syntax tree.
3) Generate code (in this case Java).
Now, in this case, some of the nodes in the syntax tree may simply be chunks of undigested Java.

Scripts for changing the address of the user when they have been in the box for 6 months

Scripts for changing the address of the user when they have been in the box for 6 months
If users are in a folder for deactivated users and disabled users in Active Directory, and been there for 6 moths do: change email address in exchange to existing email address.old
Anyone have suggestions on how I can go about it?

What is this "box"? What is this "folder" you're asking about? You'll likely get a better answer if you use standard terminology.
Ed Crowley MVP "There are seldom good technological solutions to behavioral problems."

New java-like scripting language w/ powerful regex

Hi,
Just wanted to let you know that there's now a new scripting language called P~ with the following important aspects:
1) matches and exceeds Perl regex solveability -- e.g. offers full regex-based boolean query on non-indexed corpus, offers completely general side-effects, more accurate than Perl code assertions
2) basic grammar is very Java like
3) regex grammar is algebraic, not metacharacter-based, leads to more readable and maintainable solutions to hard problems
4) offers an easy tool to debug matching behavior of your regexes (rules)
5) though a full featured scripting language, you can write scriptlets and call them from Java classes, with arguments. Allows you to use your regex solutions in Java applications.
6) the language is offered as a Java library, as well as a standalone application that runs the library. This means that your scripts can import java classes available in the classpath, you can leverage existing Java libraries.
Check out the website and try it out: http://ptilde.pbwiki.com
Andy

True to an extent. We don't yet have lookaround assertions and won't have backreferencing any time soon. But there are same-time assertions which offer much of the same, and allow for boolean query.
More accurate general statement insertion side-effects (than Perl code assertions) means that your statements are executed if and only they wrap a subpattern that is part of the ultimate best match -- Perl code assertions execute when the automata encounters them, even if where they are in the regex is ultimately not part of the match, or even if there is no match at all. This aspect is a huge part of the solveability advantage.
As to the regex test cases, there are about 1000, and we will post them soon.

Using context variable in formcalc scripting language.

Hi all,
I wanted to know if it is possible to use context variables in formcalc. I wanted to use those variables in "if else" condition in formcalc scripting language. Please post the sample code also as i am new to adobe forms.
Regards,
Vinod

Hi ,
Each variable define in the context can be used on the layout of the form and/or in script linked to fields.
This can be done in formcalc or in javascript language , without any problem . You have only to acess the correct variable in the script.
For getting variable in a script you must define the complete name of the variable, example "Myform.Header.Data.Myvariable" get access to variable MyVariable define in the context under nodes Header/Data .
Hope it's help you
regards.

High-level/scripting languages learning thread

Hi all,
In recent weeks i have looked into many of the high-level/scripting languages. All of them easy enough to get into quickly. My problem though is not learning them actually, but that i don't actually have much use now. Sure, from time to time i need a little script for something (and sometimes i then translate that script to lots of languages just for the heck of it like here), but that doesn't amount to much. However on the other hand i'm neither in some job regarding IT/programming nor do i study anything with respect to programming, and i also am not interested in more programming as in compiled languages, system programming or things like that. (At the very least not yet). So i'm doing this just for fun and learning (two of my lifegoals). I am aware of for example Project Euler, however i'm not mathematically interested enough for that.
So, the purpose of this thread are two things.
a) I'm asking for suggestions for interesting things i could do with high-level/scripting languages, maybe someone knows of something Project Euler like but for more mundane things and not maths.
b) So as to give this thread another purpose and not make it only about me, maybe people who have some problem writing a script for something can ask for help. I know of the other thread (the long one, "commandline utilites/scripts"), but that one seems to be more of the sort where someone posts a script he/she uses and then maybe someone posts an answer to that. So for this thread here people should be able to ask for help while creating the script, or even "Where to start". This could serve both the people with the problem and the people wanting to learn more about some language but not finding a way to apply the learning.
Ogion

a) I'm asking for suggestions for interesting things i could do with high-level/scripting languages, maybe someone knows of something Project Euler like but for more mundane things and not maths.
To me, this sounds like the Python Challenge: http://www.pythonchallenge.com/
Also, if you're not interested in math, maybe you might still find yourself engaged by something like natural language processing, games, or simulations? I personally find the "Natural Language Toolkit" for Python to be a lot of fun.

Repetitive error in SMTP log: illegal address syntax

Hello I keep getting this error message in the SMTP log:
Dec 17 22:33:36 chucklepunt postfix/smtpd[2909]: connect from
unknown[10.0.0.12]
Dec 17 22:33:36 chucklepunt postfix/smtpd[2909]: warning: Illegal address
syntax from unknown[10.0.0.12] in MAIL command: <W Server>
Dec 17 22:33:36 chucklepunt postfix/smtpd[2909]: disconnect from
unknown[10.0.0.12]
my mail server has this IP listed above, so it obviusoly looks like some kind of internet connection, but I don't know why it keeps happining, and I have 10.0.0.12 listed in the local hosts alias.
Thanks

I thought my problem was solved once I added 10.0.0/24 to my relay and 10.0.0.12 to local hosts in the mail setup but I am getting the error again.
You say is it in my /etc/main.cf?
Should I have that config file, because I do not, at least not in that path.
suggestions please
Thanks!

Simple statically typed scripting language for my game?

Hi, I'm looking for a scripting language for my little game. I want make game runnable on both mobile and desktop. I would like to compile scripts to native java for j2me, so they don't suffer from interpreter overhead (possiblity of running an interpreter on j2me is a plus, I can imagine it on high-end devices). On j2se, I would like to have all code to be interpreted (or dynamically compiled, whatever) so user can, for example, download new game content from the internet. Also I would like the language to be simple and cute and it does not have to provide advanced features (like closures or generators). Even classes are optional.
To sum up the requirements:
- statically typed (ideally with smart type inference). This is must in order to allow compilation.
- as simple as possibly (all I want is to define some functions and call them from the game).
- can be compiled to clean Java (byte)code. I mean, it should not wrap every int to Integer for example. Compiled code runs on J2ME.
- can be interpreted (or compiled on demand). Possibility to do this on J2ME is not required but welcome.
- direct importing of native java classes is not required (actually I don't like it, I would like to draw a clean line between scripts and the engine)
- free license (gpl is ok too)
- python-like syntax is a plus :)
Anyone ever heard about such thing? I'm prepared to implement some missing features. Actually I'm prepared to write it all if I don't find suitable starting point.

I fail to see how this is a Java Game Development Issue, or even a Java issue: what you are asking for is a scripting language that you can consequently get the freedom to run on multiple environments through compiling to Java. IMO: not a Java issue at all.

Script language problem in Address syntax

Similar Messages

Maybe you are looking for