Adobe CC Updated disappears, if it loose the focus!

Hi!
I updated the Adobe CC Updater, but I've still this issue:
If the Adobe Updater loose the focus, it disappears. Then I've to open it again via the Systray.
That is a little bit annoying, especially if you want just to use your password manager to login again, as the updater continues to forget the login credentials.
Could you please disable this "feature", that the Adobe CC Updater disappears, if it loose the focus?
The only positive thing is: It really just disappears and does not close! So the entered information are still there, but the window is not available until you reopen it. But still it's a little bit annoying!
Thanks

https://www.adobe.com/cfusion/mmform/index.cfm?name=wishform for bugs or feature requests

Similar Messages

JTextArea doesn't loose the focus

Hi everybody,
I programmed a graphical interface with two JTextAreas and six JTextFields. Using the program
means that I delete the text of both JTextAreas and paste new text. An algorithm calculates
the results. After that I insert new text and start the algorithm again. After two or three deletions
and insertions one of the JTextAreas doesn't loose the focus and I can't write on it, but I can
click to another field or area and then I have got two mouse pointer.
I hope someone has an idea.
Thank you for your help. Katja

Please post your code so that somebody may check for
you.Here the source code of one JTextArea.
seq1label = new JLabel("Target sequence:");
     sequence1 = new JTextArea("MAEPFSTILGTDGSGGRCKYLNKGIVGLGSYG", 10, 100);
     sequence1.setFont(fontplain);
     sequence1.setBackground(general.BACKCOLOR);
     JScrollPane scrollpane1 = new JScrollPane(sequence1);
     JPanel panelseq1 = general.makePanel();
     panelseq1.setLayout(new BorderLayout());
     panelseq1.add(introduction, BorderLayout.NORTH);
     panelseq1.add(seq1label, BorderLayout.CENTER);
     panelseq1.add(scrollpane1, BorderLayout.SOUTH);
I hope it is enough.

I cannot download Adobe Reader update

I want to know why I cannot download Adobe Reader update? I went to the Adobe website without success. I'm experincing problem watching some movies or anything similar on Youtube because Adobe Reader is not up to date. So, I followed the instruction for downloading the new update, but, it stops at 97% and I getting a message to close Safari, although, the Safari is closed when installing the update. what should do for the proper installation?
<Subject Edited by Host>

Sorry, none of that worked. Its very frustrating.
Also, since the last upgrade, which seems almost automatic, half of the icons for my bookmarks and actual websites have disappeared.
I haven't upgraded to Mac OS Lion, is that part of these problems?

Error:1602 , Adobe Acrobat Updater - Update Failed

My operating system is Windows 7 Professional, 64-bit
After installing Creative Suites 4 and downloading updates, I received an Acrobat Updater notification that Updates were available.
I clicked on the Adobe Acrobat Updater icon and ultimately got the following Error.
Adobe Acrobat Updater, Update Failed, Error:1602
This was solved by going to C:\ProgramData\Adobe\Acrobat\9.2\ARM
I deleted the contents of the ARM folder and then ran "Check for Updates" from Adobe Acrobat. This re-populated the ARM folder with the correct folder and files. Updater ran and I followed the instructions to restart my computer and now it works well.

Ronald Segerstrom for questions regarding an Acrobat specific update please repost your inquiry to the Acrobat Windows forum.

My Adobe Acrobat upadte failed w Error 1321 The installer has insufficinet privileges to modify file.... I followed the Adobe online instructions to change the advance settings. Now trying to reinstall my Adobe Acrobat but I do not see the download optio

My Adobe Acrobat update failed w Error 1321 The installer has insufficient privileges to modify file.... I followed the Adobe online instructions to change the advance settings.
Now trying to reinstall my Adobe Acrobat but I do not see the download option when I sign in to my Adobe account. Please help.
Also want to confirm that I uninstall my Adobe Acrobat before REinstalling.

error 1321 the installer has insufficient privileges to modify this file c:\program files\adobe\reader 11.0\reader\arh.exe....also i tried reinstall but still receive error message...
error 1321 the installer has insufficient privileges to modify this file c:\program files\adobe\reader 11.0\reader\arh.exe
need your help please

Open URL Ivew in a new window without loosing the current session in Portal

Hi All ,
I have a requirement in which there are two tabs in portal which are two roles A and B
Where each tabs(role) has an URL Iview attached to it.
Current I am in Window 1 - Tab A
When I click on Tab B, it has to open in a new window (Window2) with Tab B content , where as the previous session (Window1)is not lost and Window1 has to show Tab A only.
Kindly help me out on how to implement it .
Thanks in Advance

Hi All ,
Thanks for the reply and sorry for the late response.
As per Prashant I made the setting .. When I click Tab 2 in Window 1, opens a new window 2 with Tab 2 iview .but the window 1 is hilighted with Tab B and the current session on Tab A is lost . As per the reqiirement I should not loose the focus on Tab A in Window1.
also Kindly let me know how and where can I sent the EPCM paramenter for the URL Iview .
Thanks in Advance
Edited by: Prasanna Kumar on Feb 21, 2012 12:42 PM

Problem: who has the focus when a comp lost the focus

I've a JPanel with textfields. When I loose the focus of the textfield I validate the input. So far so good. When I click outside the panel the validation shouldn't be made. But I can't add Listeners to all the other panels, because it should be dynamic. I know in java1.4 there is the possibility to get to know who the owner of the Focus is.
I use jdk1.3.1.04.
Thanks.
christian

Hi,
We had same problem.
Maybe its not the best idea, but its working.
We made managed bean,which can requery, and focus row on iterator.
We force to requery the iterator like this:
FacesContext fc = FacesContext.getCurrentInstance();
ValueBinding vb =
fc.getApplication().createValueBinding("#{data." + iteratorName+ "}");
DCIteratorBinding ib = (DCIteratorBinding)vb.getValue(fc);
ib.executeQuery();
Later we force iterator to focus on key on which it was:
ib.setCurrentRowWithKeyValue(KEY);
KEY is String and is passed before commit.

When I try to read a PDF file, the window opens and then disappears after a second or two. This began after the last Adobe update. I tried accepting the Adobe terms using Eula.exe but that disn't solve the problem. What do I do?

I can no longer read PDF files. The window opens and then disappears after a second or two. This began after the last Adobe update. I tried accepting the Adobe terms using Eula.exe but that disn't solve the problem. What do I do?

Can you open Adobe Reader by itself? If so, try disabling Protected Mode [Edit | Preferences | Security (Enhanced)].

Adobe PremCS5.5.0 works but after the update to CS5.5.2 it crashes

Adobe PremCS5.5.0 works but after the update to CS5.5.2 it crashes, it starts with loading some modules from Premiere and then disappears from srceen.
When I reload my old image again on the disk, CS5.5.0 works again
Will it help to do first a manual upgrade to CS5.5.1 and then CS5.5.2, or ???

Hi,
the problem "it starts with loading some modules from Premiere and then disappears from srceen." can be solved by booting premiere while keeping the SHIFT and ALT key pressed until premiere ist totally loaded. That operation resets premiere. It's important to press the keys immediatly after starting premiere. Best way to do this, select the icon and press enter to start the programm (you can react faster than using double click). And remember to hold the keys during the whole boot process. The reset was successfull when the list of resent projects is empty, and in your case if premiere finaly starts.
Good luck
Johannes

Hi - I am looking for the Adobe Illustrator 2014 1.2 (or .0.2) bugfix update for Mac - and it is not visible in the Adobe Creative Cloud Packager (Mac version). The only update visible is Illustrator CC 2014.1 - which is what introduced the bugs.

Hi - I am looking for the Adobe Illustrator 2014 1.2 (or .0.2) bugfix update for Mac - and it is not visible in the Adobe Creative Cloud Packager (Mac version). The only update visible is Illustrator CC 2014.1 - which is what introduced the bugs.
The only thing that I can think of that might be causing the issues that I have a Mac Mini on Mavericks.
Dave

Hi
I have discovered that my question above is a non-question. A user triggered by looking at the below article about Illustrator 2014 cc 17.0.2
http://helpx.adobe.com/illustrator/release-note/illustrator-17-0-2-release-notes.html
He had recently upgraded from wht we now know is 18.0 to 18.1 which is the latest version. He read the above artic
le and supposed that it was a bug fix release for his version - because the v17 ov18 number is not often displayed. It is usually just 2014 CC.
I have asked him to post a bug report about Adobe Illustrator CC 2014.1
Dave

I've 2 problems. I wanted to install Lightroom CC. On my desktop, the update of Adobe CC itself fails. On my laptop, Adobe CC updates, Lightroom CC installs, but Lightroom CC doesn't start. It flickers very briefly in Task Manager, but is gone immediately

After several restarts the Adobe CC update worked on the desktop. Doing the LR CC install on the desktop now.

Thanks for the reply Rave, but unfortunately that does not address my problem - my PC comfortably exceeds the minimum spec for the applications.
Of the three onward links from that page -
(1) "For additional information please see Creative Cloud Help | Missing CC apps from my Creative Cloud Desktop app" is a dead link (>"Sorry, this page is not available")
(2) "If you have confirmed that your computer meets and exceeds all of the listed System requirements then please see CC desktop lists applications as "Up to Date" when not installed." I had already worked through the 'solutions' on that page, culminating in the (bad) advice in 'Solution 4' which is what has got me into this current mess;
(3) "If you have already have Download Adobe Creative Cloud application you can use Download Center : Adobe Creative Cloud for your Product Download." isn't helpful as the download links send me back to the CC Desktop app, & it still won't allow me to download the 'CC' or 'CC (2014)' applications.
Thanks again, but do you have any other suggestions?
Ian

Hi. My new computer had Acrobat on it. Suddenly, I was unable to open any PDF's. and then I tried to update and was forwarded to the Adobe site that said I had to buy a monthly subscription. I do not have the physical box with a serial number and was

Hi. My new computer had Acrobat on it. Suddenly, I was unable to open any PDF's. and then I tried to update and was forwarded to the Adobe site that said I had to buy a monthly subscription. I do not have the physical box with a serial number and was going to buy the one advertised on the website until I discovered it's only for students and teachers, which I am not. What should I do next as I need to use PDFs on a daily basis. Thanks! I would like to be able to download this and pay online. Possible? I currently have Adobe Acrobat XI Pro. I have a Windows 7 system. Please help!

As long as you know your serial number you can download PSE from here:
Download Photoshop Elements products | 11, 10
If you don't know your serial number:
Find your serial number quickly

I updated my spouses iphone with the same apple id, now he is recieving my texts. how do i change without loosing his data?

I updated my spouses phone using the same apple id. I must have clicked ok to something i shouldnt have at some point.....because now he is recieving my texts! I still recieve my texts, but he also recieves them.
I went to restore his phone but it said it would only restore to factory settings and i dont want to loose the data.
How do i solve this?

Try settings, messages, tap on send & receive, there should be phone number options to choose from...uncheck your phone number.
This is an added feature to allow a user to see messages across multiple platforms like your iPad and iPhone.

Why doesnt Adobe just UPDATE Flash Professional? Arent they reinventing the wheel?

Congratulations on getting to open beta with Flash Catalyst!
I know its late in the game to mention something like this but why didnt Abobe just update Flash Professional?
It seems that the arguments for flash Catalyst center around the following:
1) smooth workflow between Photoshop & Illustrator, especially because of the same layer view
2) No coding required to create components out of artwork
3) Can create FXG and FXPs to be used in Flash Builder
4) Can create multi screen aplications
1) 2) and 3) could all be solved by adding a new types of symbols to Flash Professional's 3 currently available symbols(MovieClip, Button, Graphic)
1) could be solved by adding a new Sprite symbol.
Flash Professional needs to be updated to keep up with and match the structure of AS3 anyway.
Sprites were added in AS3 and now wireframe components are being added to the code structure, why not just at that on the design side as well?
Sprites are essentially MovieClips with out a timeline.
So if you created a new Sprite symbol and opened it up in the timeline, you would only see one frame with folders and layers.
A Sprite symbol is essentially organized the in layers and folders and would just like a photoshop file.
And if you really want it to look like a Photoshop layout, then you just move the timeline view over to the right.
This would solve problem 1. Designers could import their artwork into Flash Professional as a Sprite and it would be a seemless experience.
Obviously I'm not saying that a bitmap is a sprite. But I am saying that layers of bitmaps and could be organized inside of a Sprite. And the designer could turn any of the assets into a Button, MovieClip, Graphic, Sprite, and hopefully other Classes and WireframeComponents available in Flash.
2)&3) could be solved by adding a new Symbols for the new Wireframe Components. The Button symbol already has a template with 4 states. Why not update Flash Professional to visually represent more Classes and Component Classes, instead of just the MovieClip Class and the Button Class. Even better, maybe there could be a way to make a template for creating our own wireframe components. Just assign a base class for the wireframe class and a base template, and the introspection view will display accordingly.
States of the component would be listed out at the top instead of frames, just like the Button Symbol used to be. Different layers could be designated for specific graphical parts of the component. The designer would be free to add their own layers if necessary.
In previous versions of Flash, everything was a movieclip and everthing had a timeline. Thats not the case anymore. The timeline is for intropecting MovieClips, but this view could be different when intropsecting different types of symbols such as Sprites, Buttons, Wireframe Components, and even Custom Wireframe Components(extensible).
These new Symbols and also Sprites could export to FXG very easily.
The multi screen applications in 4) look pretty similar to the Slide Presentation Template. Why not just make a new MultiScreen App Template and youre done. these MultiScreenApp Templates could exporte Screens to FXG or export the whole Template to a FXP.
I applaud the work done on the new wireframe components and FXG. Great Job!
But, just cant understand why you cant update Flash Professional with new types of Symbols(Sprites, new Buttons and wireframe Component Classes) and a new MultiScreen App Template.
Flash Professional needs to keep up with AS3 and also needs to export FXG and FXP.
Why doesnt Adobe focus on on this rather than create a new Tool? These features need to be added to Flash Professional anyway.
Isnt there more of a disadvantage to having 2 tools for designers that do the same thing?
I'm sure this issue has been debated before. Can anyone point to me links that have the arguments for creating a separate tool instead of updating?
Has anyone ever suggested that Flash Professional should keep up with AS3?
Has anyone ever suggested making Sprites a new symbol in Flash Professional so that it could be more seamless with Photoshop?
Has anyone ever suggested make Wireframe components in Flash Professional like the Button Symbol in Flash Professional?
Has anyone ever suggested updating Flash Professional so that it would export FXG and FXP?
What is your opinion on this?
-thomasglyn

@Ross
Thanks for your explanation. I appreciate your feedback.
I'm glad we agree that ideally there should be 2 main tools, one for designers(Flash Professional) and one for programming(Flash Builder).
You had mentioned "But, that assumes this is possible. As it currently stands it is not" and the reason being "Catalyst, and Builder both use a completely different framework from Professional. The component architecture is drastically different, not to mention the entire backend of the software.".
You could also argue that, the reasons to make a separate flex component creation tool like Flash Catalyst assumes that updating Flash Professional CS4 is NOT possible. But is the statement about the framework being entirely different really true?
Well, that depends on what you mean by the term "framework".
Framework can refer to 3 things in this case.
1) the component framework
2) the code framework(AS3)
3) the flex framework (mxml, fxg)
If you are refering to #1 then you're right, because Adobe hasnt updated the flash component framework in Flash Professional from Flex3 Halo components to Flex4 Spark components.
Flash components have gone through many iterations, and the switch from AS2 to AS3 was probably more profound than the new wireless component structure(Spark). And now that we have AS3, isnt the only difficulty creating a intuitive UI in Flash Professional, and adding export features?
If you are refering to #2 then I think you're incorrect, because Flash Professional has been updated to AS3 and Flex4 Spark components use AS3. I would totally agree with you, if CS4 did not go through all of the trouble updating to AS3.
If you are refering to #3 then you're right, because Flash Professional doesnt export mxml, fxg, or fxp, but with a little creativity, it would probably be possible to allow such an export. Adding FXG/FXP export features could be solved by creating a new type of project file. Adobe did this for AS2, AS3, flash lite, etc. Why cant they just make a new AS3/FXG file that only allows you to build fxg/fxp exportable assets.
Why cant Adobe make a Sprite class the default document class for AS3/FXG projects and when some adds a movie clip asset, export movie clips as swfs or swcs?
So to be honest, after opening up Flash Catalyst again and looking at it again, I almost get the feeling that its just a Flash Component creation tool with a Photoshop UI, for the new AS3/Flex 4 components(Spark components) that Adobe just refuses to add to CS4. CS4 uses AS3 and Spark components use AS3. CS4 needs to be a visual design tool for all the classes in AS3(as much as possible).
Perhaps Adobe originally meant to name this product...
ADOBE FLASH COMPONENTS
Or maybe Adobe Flex Components(but thats no longer true, because Flex 4 will be Flash Builder).
In regard to "reinventing the wheel". Flash components have been reinvented several times, and I totally agree with you that this is important to "reinvent" components to keep up with new techiques as2,as3,fxg. You are right, this is a positive thing. However in this case, I am using "reinvent in a negative sense.
So maybe I shouldnt say "reinvent the wheel", but "reinvent the car".
Perhaps Adobe is trying to create a wheel for the upperclass RIA programmer Flex car, and isnt making it compatible common designer/programmer Flash car. And when they finished the wheel, and they decided just to make a Segway for the Designers and Flash people to ride, that uses this new wheel.
You might argue that its more approachable for designers, and designers feel at home because the ui is similar. This is precisely why Adobe should hurry up and finish updating the ui of the Flash Professional IDE so that its ui is more compatable with Photoshop and Illustrator. The fact that Photoshop and Illustrator is the standard for designers are perhaps one of Adobe's greatest advantages. They could make the designers happy if they just make a Sprite inspector view with layers like photoshop in Flash Professional, instead of using the old "everything
is a movieclip" paridgim. Flash Professional has already upgraded to AS3 and in AS3 everything isnt a movieclip. So it would be nice if they could make views for some of the new classes and wireframe components.
This is the age old debate, update or start from scratch. I guess I'm saying that I think the hard work of updating to AS3 has already been done, and its just plain wierd that Adobe decides to build a separte tool for components, when they use the same AS3 code base.
Its just insanely exciting to just think about what could have been if Flash updated and brought on more Designers and at the same time linked in the Flex community. Thats what Flash has always been about! The meeting point between Designers and Programmers.
To go this far and quit just because of components just leaves me blue.
It seems that many projects stop at 80% complete and if the developers just spent the extra 20% on fine tuning things then they would have a very high quality product. In this case the remaining 20% is components, ui, and export. I understand that there are probably many things I dont understand, especially when you through in marketing, and product life cycle.
But I think Adobe could have done it, if they put as much effort into it as they did to make an entirely new product.
Maybe we should make some noise before its too late.
I'm still interested in seeing more links that show the logic behind the initial discussions of this debate when it was first decided.
pls keep me posted.
@nwfa & macsavers
Yes, youre right. it does seem to be their plan. I just hope they are just testing the waters. Perhaps after they do the initial selling of Flash Compenents, then maybe they could offer a free update to CS4.
As I mentioned above, the main reason designers feel at home is because of the UI of Flash Catalyst. UI's can be updated, and I believe Flash Professional can and should update itsui for the reasons I mentioned above.

My daughter's ipod nano shows up in "devices" when I plug it in...but it disappears. Right away it says it needs to update, but then after extracting the files it comes back and says that it can't be updated because it can't be unmounted. help?!

My daughter's ipod nano shows up in "devices" when I plug it in...but it disappears. Right away it says it needs to update, but then after extracting the files it comes back and says that it can't be updated because it can't be unmounted. help?!

When in DFU mode and connected to the computer iTunes does not say anything but iTunes will see the iPod and you can restore the iPod via iTunes. When in recovery mode and you connect, iTunes will say it found an iPod in recovery mode.

Adobe CC Updated disappears, if it loose the focus!

Similar Messages

Maybe you are looking for