BODS scripting language
Hi Experts
I am working on SAP BODS i need to learn scripting language to write scripts in BODS Jobs.So please provide me a source or web link to learn scripting language.
Thanks in advance
P.Prasanna Kumar.
See if you find this useful to learn scripting in DS.
Data Services Scripting Language
Similar Messages
-
SAP Scripting Languages on the SDN Day - Amsterdam
I would like to give a short summary of what happened on the SDN Day in Amsterdam, the 17-th Oct. 2006.
After the breakfast Craig Cmehil gave us a welcome to the event and presented the schedule. We started with a power networking session: Four 20-minute Sessions with Six SDNers per Table. As I was sitting at the Scripting Languages table, I would like to share some impressions of the atmosphere there. We talked much about the emmerging SAP Scripting Tool and how much value it will bring to all scripting projects that plan to utilize SAP backend systems. We discussed Gregor Wolf's contest and he was so kind to inform us that his test system is also available inside the SAP corporate network, so all SAP employees now can participate too. Gregor works for Siteco Beleuchtungstechnik GmbH and the award they offer for the contest is a Siteco Vistosa task light. More information about the contest can be found at https://www.sdn.sap.com/irj/sdn/weblogs?blog=/pub/wlg/4588. [original link is broken] [original link is broken] Another key discussion was held with Björn Schotte, the chief editor of PHP Magazine, Germany, presenting also his company Mayflower Gmbh. He shared some visions on business applications of PHP and stated that PHP is definitely enterprise ready.
Then after a very short pause we started the SDN breakout sessions (3-5 in parallel). I visited the sessions of Gregor Wolf, André Labahn, Björn Schotte and after this I cooperated for the breakout session of Frank Mittag.
Session 1:
Connecting Typo3 to R/3 Enterprise via Web Services with Gregor Wolf from Siteco Beleuchtungstechnik GmbH
Siteco Beleuchtungstechnik GmbH currently implements a customer service centre into it's Typo3 based website. Typo3 is an Open Source Web Content Management system based on the Scripting Language PHP. The application will allow Siteco's customers to directly check price & availability of products from the backend R/3 Enterprise system, quotations, orders and delivery status. The backend connectivity uses Web Services utilise the PEAR SOAP Package.
Session 2:
SAP supports Scripting Languages with Andre Labahn from SAP.
This session will provide you with more insights on how SAP is supporting scripting languages.
Session 3:
Scripting Languages PHP and Enterprise Software with Björn Schotte (Chief Editor from PHP Magazine).
This session showed us a brief history of PHP and PHP in Germany. Some enterprise applications of PHP were discussed. Björn Schotte was the opinion that PHP is definitely enterprise ready and he proved it with an example of a system that his company has created for Siemens.
Session 4:
Scripting Languages Tool with Frank Mittag and Vasil Bachvarov (me) from SAP
SAP will provide a open source tool to the scripting development community that is supporting the access to SAP Backend Systems via RFC/BAPIs and Webservices. See the concept and demo of the tool and discuss this with SAP Development.
There was a pretty interesting discussion about the tool. Since the time for the last session shrinked with some minutes we had to be very quick, but Frank Mittag did a great job and succeeded to explain the basic concept of the SAP Scripting Tool and show it in action for the tough time constraint.
There were a lot of questions from the audience but it was already 18:30 and we stopped at this point. There would be a second chance for questions on thursday when Frank had the opportunity to make a more complete and comprehensive walk-through of the project.
Then we gathered in the meeting hall and Shai Agassi held a speech and made a summary of the event.
The evening finished in the BoomChicago theater where everybody received a delicious meal, drinks and a great amount of fun with the ChicagoBoom comic crew.
I would like to thank all people that made this event come true! See you soon in Bangalore.
Best Regards,
Vasil Bachvarov
SAP AGI'm be there in Amsterdam as well. In fact I am leaving the US on Sunday and arriving early Monday morning in Amsterdam.
I was planning to do a little site seeing on Monday Afternoon. If anyone else is arriving a bit early as well, they are welcome to join me. It is always more fun to site see in groups. My email address is public in my SDN business card (also not too difficult to figure out ) if anyone is interested in meeting up. -
Looking for a more universal scripting language than AppleScript or Automator
I want to learn a cross-platform/web scripting language to automate tasks, write scripts and with the potential to create programs and web apps.
I am looking for something that:
- is not a program with a GUI like Automator, iKey, Quickeys, Maestro...
- is more "universal" than Applescript, cross-platform
- can be used to automate simple tasks in a simple way
- can also be used to create more complex scripts, web apps and maybe, eventually, programs (with GUI)
I've read about Javascript, Python, Ruby, PHP, Perl, C+, C++, Java and others, but I really don't know.
- Java sounds pretty cool, Python too.
- I'm not crazy about PHP or Perl, with Javascript, but some people swear by it
- I don't know anything about C+, C++
Does anyone have any suggestion(s)? Please let me know if you need any more details. Thank you.C, C++, Objective-C are nor scripting languages and will not help you do web pages. (Don;t know what C+ is).
Forget Java it has lots of security problems and more and more users are disabling Java in their web browsers because of this. Developing in Java would be, in my opinion, a mistake.
If you are doing any web works at all you will need to know some Javascript, no way around that. But Javascript is actually not a bad language
Note Java and Javascript are two totally separate languages that have nothing in common but the first 4 letters of their names.
So you are left with PHP, Perl, Python and Ruby.
Dismissing PHP and Perl out of hand is a big mistake, They are both major players and you will run into them just about everywhere. If you are looking to do this for possible employment you will need to be familiar with them at least.
Python and Ruby are both strong languages as well. I don't have a lot of experience with either so I can;t speak to their strengths but learnign either would not be a mistake.
Knowing what your reasons are for asking this, personal use or for employment, might help refine the list some.
regards
Message was edited by: Frank Caggiano - Perl is also included in OS X by default. Not sure about PHP but I believe it also is. I agree TextWrangler would be a good editor for this type of work. -
How to create a scripting language in java?
Hello,
All that I want to do is to create a scripting language in java. I�m familiar with javacc, jsr223 and other things but don�t know how to start. The language syntax is java 5 syntax with some change and I want to generate java source code from small scripts. In fact I don�t know how other languages (like groovy) are created.
I hope you can show me the required steps.
Looking forward to hear from you.
Thanks.That's all, huh?
For a start, generally when I hear "scripting language" I'm thinking interpretter, not a system which creates compiled (or compilable) code.
I get the impression that what you're talking about is what I'd call a "preprocessor" language, some extra syntax added to java which the preprocessor renders into ordinary java.
As far as complexity is concerned, much depends on how deeply involved the extra syntax is with the embedded ordinary Java. Does you preprocessor need to understand the java, or is it just embedded as text? How easilly identified are your preprocesor statments? It's a lot easier to do this if preprocessor lines are instantly identifiable from Java code (e.g. start with a #).
Basically the stages are always the same;
1) Lexical analysis i.e. picking out words, operators, numbers, quoted strings.
2) Construct a syntax tree.
3) Generate code (in this case Java).
Now, in this case, some of the nodes in the syntax tree may simply be chunks of undigested Java. -
About about scripting language
I'm looking to getting some training on scripting language to use on SCCM. Any advise which I should focus on? VBscript or Powershell. I need to create Configuration Baselines and most of the examples I've seen uses scripting.
Also can anyone suggest a good resource for training on Report Builder. Thanks.would recommended to go with Powershell as it automates lot of things using builtin configmgr commands
here you go with built-in Powershell commands in configmgr http://technet.microsoft.com/en-us/library/jj850100(v=sc.20).aspx
Eswar Koneti | Configmgr blog:
www.eskonr.com | Linkedin: Eswar Koneti
| Twitter: Eskonr -
Details about Script language for "Replacement" in email templates
Dear All,
I am using Send Notification callable object for sending emails. And I have designed a template for the same.
Now I know that while using Replacements I can't display context attributes of type "LIST".
So is there any way to achieve this??? Can I make use loop statement in script language of Replacement??
Can anybody tell me where do I find the sample usage of script language?
Thanks and regards,
Amey MogareHi,
Please refer this
http://help.sap.com/saphelp_nw04s/helpdata/en/43/f9097d1b607061e10000000a1553f6/frameset.htm
-Ashutosh -
Scripting Language Options for the Script Task Options SSIS 2012
Can python or perl be used as a script language in the drag and drop script task? I believe only VB.Net and C# are, but I see under SSDT Tools -> Options there are some choices for Python Debugging? I'd like to use python as my SSIS scripting language
in some cases. If it can not be used as the script task language, what are the Python options under Tools -> Options for?
Any experts out there who can illuminate?
Thanks allHello,
In SSDT in a SSIS Script task you can only use Visual Basic.NET and C#, no other programming / scripting languages.
SSDST is a plugin for Visual Studio and in VS you will find several options which are irrelevant for SSIS projects, like this Phyton debugging option.
Olaf Helper
[ Blog] [ Xing] [ MVP] -
I've found this line of code in my formsweb.cfg file, but to be honest I have no clue what it's doing.
HTMLbeforeForm=<SCRIPT LANGUAGE="JavaScript">window.opener = top;</SCRIPT>
Anyone know what this code might be responsible for?I have seen this sometimes used to prevent the user being asked if they want to close the window when a javascript command to close the window is issued. Not sure it always works with different browsers or versions.
-
New java-like scripting language w/ powerful regex
Hi,
Just wanted to let you know that there's now a new scripting language called P~ with the following important aspects:
1) matches and exceeds Perl regex solveability -- e.g. offers full regex-based boolean query on non-indexed corpus, offers completely general side-effects, more accurate than Perl code assertions
2) basic grammar is very Java like
3) regex grammar is algebraic, not metacharacter-based, leads to more readable and maintainable solutions to hard problems
4) offers an easy tool to debug matching behavior of your regexes (rules)
5) though a full featured scripting language, you can write scriptlets and call them from Java classes, with arguments. Allows you to use your regex solutions in Java applications.
6) the language is offered as a Java library, as well as a standalone application that runs the library. This means that your scripts can import java classes available in the classpath, you can leverage existing Java libraries.
Check out the website and try it out: http://ptilde.pbwiki.com
AndyTrue to an extent. We don't yet have lookaround assertions and won't have backreferencing any time soon. But there are same-time assertions which offer much of the same, and allow for boolean query.
More accurate general statement insertion side-effects (than Perl code assertions) means that your statements are executed if and only they wrap a subpattern that is part of the ultimate best match -- Perl code assertions execute when the automata encounters them, even if where they are in the regex is ultimately not part of the match, or even if there is no match at all. This aspect is a huge part of the solveability advantage.
As to the regex test cases, there are about 1000, and we will post them soon. -
How text data is formated in post script language level 2
Hi all,
In post script language level 3 files text data is converted to hexadesimal format and kept in between xshow commands. But in postscript language level 2 files, text data is converted to some other format.
Can you please inform me, to which format text data is converted.
Thanks,
Sateesh.PostScript: Level 2
-
Using context variable in formcalc scripting language.
Hi all,
I wanted to know if it is possible to use context variables in formcalc. I wanted to use those variables in "if else" condition in formcalc scripting language. Please post the sample code also as i am new to adobe forms.
Regards,
VinodHi ,
Each variable define in the context can be used on the layout of the form and/or in script linked to fields.
This can be done in formcalc or in javascript language , without any problem . You have only to acess the correct variable in the script.
For getting variable in a script you must define the complete name of the variable, example "Myform.Header.Data.Myvariable" get access to variable MyVariable define in the context under nodes Header/Data .
Hope it's help you
regards. -
High-level/scripting languages learning thread
Hi all,
In recent weeks i have looked into many of the high-level/scripting languages. All of them easy enough to get into quickly. My problem though is not learning them actually, but that i don't actually have much use now. Sure, from time to time i need a little script for something (and sometimes i then translate that script to lots of languages just for the heck of it like here), but that doesn't amount to much. However on the other hand i'm neither in some job regarding IT/programming nor do i study anything with respect to programming, and i also am not interested in more programming as in compiled languages, system programming or things like that. (At the very least not yet). So i'm doing this just for fun and learning (two of my lifegoals). I am aware of for example Project Euler, however i'm not mathematically interested enough for that.
So, the purpose of this thread are two things.
a) I'm asking for suggestions for interesting things i could do with high-level/scripting languages, maybe someone knows of something Project Euler like but for more mundane things and not maths.
b) So as to give this thread another purpose and not make it only about me, maybe people who have some problem writing a script for something can ask for help. I know of the other thread (the long one, "commandline utilites/scripts"), but that one seems to be more of the sort where someone posts a script he/she uses and then maybe someone posts an answer to that. So for this thread here people should be able to ask for help while creating the script, or even "Where to start". This could serve both the people with the problem and the people wanting to learn more about some language but not finding a way to apply the learning.
Ogiona) I'm asking for suggestions for interesting things i could do with high-level/scripting languages, maybe someone knows of something Project Euler like but for more mundane things and not maths.
To me, this sounds like the Python Challenge: http://www.pythonchallenge.com/
Also, if you're not interested in math, maybe you might still find yourself engaged by something like natural language processing, games, or simulations? I personally find the "Natural Language Toolkit" for Python to be a lot of fun. -
Scripting Languages Tool Preview
Ok, this new thread is for posting about the Scripting Languages Tool Preview. Any comments, thoughts, ideas, contributions?
Greetings,
Blag.John: as Frank said, we'd love to see generators for other languages - like JavaScript - in future. But we don't want to create them all alone. So here's the deal: we create the framework and some generators for the most widely-used languages and you cool guys on SDN build on that and create other generators, other viewers, anything you think is useful. And for all questions or problems we (SAP Scripting Team) will offer all the help we can. I'm very looking forward to see what will evolve from this
This works two-way. It's you who have year-long experience in all kind of scripting languages - combined it's much more knowledge than we can have. So when I face a scripting problem during generator-creation I'll just ask for your help here
Piers: no, it did not arrive. Please send again. I checked my profile and the mail-address was just not set to 'visible'. Your's isn't, too
About the 'integration': it is a clear goal to let it work inside other frameworks (Eclipse-based). As we do not have or use all of these I can just assume that it'll work just fine using the standard Eclipse mechanisms. Scripting in a Box is definitely a good candidate for this, and I myself use it for testing both tool integration and generated scripts.
Bundling - we thought about this, but there might be legal issues, so we have to wait for an official approval. Meanwhile it's not that complicated just getting SiaB and installing the tool afterwards
:Frederic: -
Scripting Language -how to enter double quote
Hi Everyone,
On scripting language (Python), at call settings tab, under argument expression -how do I enter the following argument:
-z "c:\Program Files (x86)\7-Zip\7z.exe" -d 192.168.1.50 --fl2 myFilename.fl2 --fl_sel vf_oy
Python script calls "c:\Program Files (x86)\7-Zip\7z.exe" as part of the argument.
The complete call:
python fth.py -z "c:\Program Files (x86)\7-Zip\7z.exe" -d 192.168.1.50 --fl2 myFilename.fl2 --fl_sel vf_oy
I am using Teststand 2012. Thanks,
FrankHi Doug,
Thanks for your help and after running with suggested solution I got code error 2 from Python script:
"-z \"c:\\Program Files (x86)\\7-Zip\\7z.exe\\\" -d 192.168.1.50 --fl2 myFilename.fl2 --fl_sel vf_oy"
However it works fine if I remove the last two "\\"
"-z \"c:\\Program Files (x86)\\7-Zip\\7z.exe\" -d 192.168.1.50 --fl2 myFilename.fl2 --fl_sel vf_oy"
Thanks for your help.
Frank -
Perl versus other "scripting" languages when doing string operations
I've been told that perl is a "scripting" language like the other languages mentioned in this forum.
If that's true, can these other languages handle the following spec as well as perl can? (See spec at end of this post.)
Or is perl stronger in string operations than the other scripting languages mentioned here?
Here's the spec:
1. I give your program a twenty-letter alphabet (any twenty letter alphabet)
For example:
ABCDEFGHIJKLMNOPQRST
2. I also give your program four groups (any four groups) of letters in this alphabet:
For example:
s: A,B,C,D,E
p: F,G,H,I,J
d: K,L,M,N,O
e: P,Q,R,S,T
3. I also give your program a sequence over the twenty-letter alphabet that I gave you in Step (1) above:
For example:
ABCDEFGHIJKLMNOPQRSTSRQPONMLKJIHGFEDCBA
4. Given this sequence,you search for pairs of adjacent letters (x,y) where X and y are from different groups (the groups defined in Step (2) above.)
Also, you return the results of this search by giving me back the following two strings:
ABCD(EF)GHI(JK)LMN(OP)QRSTSRQ(PO)NML(KJ)IHG(FE)DCBA
ABCD(sp)GHI(pd)LMN(de)QRSTSRQ(ed)NML(dp)IHG(ps)DCBA
5. Note: if I give you a sequence that contains "overlapping" ordered pairs like:
...EFK...
then you ignore the second ordered pair. That is, you return:
...(EF)KOK - here is the final stuff on the "C" side.
To execute the program, the command line is:
20let.exe file1.txt file2.txt file3.txt > fileout.txt
Below, I've provided:
a) source code 20let.c
b) sample input file1.txt
c) sample input file2.txt
d) sample input file3.txt
e) output fileout.txt generated from these input files.
As soon as Bill finishes the perl version of the source code, I'll post that also.
source code of 20let.c
// 20let.c5
#include <stdio.h>
#include <stdlib.h>
int T[333],A[99999],G[333],B[99999],C[99999],N[299999],P[99999];
int n1,n2,f,p,x1,x2,n,m,a,b,c,i,j,k,x,y,z;
int E[233][233];
FILE *file;
int substrings(int x1,int x2);
int main(int argc, char*argv[]) {
if(argc<3){
printf("\nusage:20let protein-file nucleotide-file pairs-include-file\n\n");
printf("marks amino-acid-pairs from different groups in protein-file\n");
printf("iff they are in the include-file\n");
exit(1);
//----------------define the groups G['I'] = 's', e.g.
x='s'; G['I']=x;G['M']=x;G['V']=x;G['A']=x;G['G']=x;
x='p'; G['F']=x;G['L']=x;G['P']=x;G['W']=x;G['W']=x;
x='d'; G['H']=x;G['Q']=x;G['D']=x;G['E']=x;G['E']=x;
x='t'; G['S']=x;G['T']=x;G['Y']=x;G['N']=x;G['C']=x;G['K']=x;G['R']=x;
//----------------the 4 bases T['a'] = 0 thru 3
for(x=0;x<222;x++)
T[x]=-999;
T['a']=0;T['c']=1;T['g']=2;T['t']=3;
T['A']=0;T['C']=1;T['G']=2;T['T']=3;
for(i=65;i<70;i++)G<i>='s';
for(i=70;i<75;i++)G<i>='p';
for(i=75;i<80;i++)G<i>='d';
for(i=80;i<85;i++)G<i>='t';
//---------------- read include-file file3 xxxyyy pairs E[x][y] of interest
f=0;
for(x=0;x<222;x++)
for(y=0;y<222;y++)
E[x][y]=0;
if((file=fopen(argv[3],"rb"))==NULL){
printf("\ncan't open exclude-file %s\n",argv[1]);exit(1);
mq1: if(feof(file))
goto mq3;
x=fgetc(file);y=fgetc(file);x=fgetc(file);
x=T[fgetc(file)]*16+T[fgetc(file)]*4+T[fgetc(file)];
y=T[fgetc(file)]*16+T[fgetc(file)]*4+T[fgetc(file)];
if(x<64 && x>=0 && y<64 && y>=0){
E[x][y]=1;
f++;
mq2: if(feof(file))
goto mq3;
a=fgetc(file);
if(a!=10)
goto mq2;
goto mq1;
mq3: fclose(file);
//------------------read amino-acid file file1 == P array
if((file=fopen(argv[1],"rb"))==NULL){
printf("\ncan't open file %s\n",argv[1]);exit(1);}
p=0;
m1p: if(feof(file))
goto m2p;
p++;
P[p]=fgetc(file);
if(G[P[p]]==0)
p--;
goto m1p;
m2p:;
fclose(file);
//------------------read nucleotide file file2 == N array
if((file=fopen(argv[2],"rb"))==NULL){
printf("\ncan't open file %s\n",argv[1]);exit(1);
n=0;
m1n: if(feof(file))
goto m2n;
n++;
N[n]=fgetc(file);
if(N[n]!='a' && N[n]!='c' && N[n]!='g' && N[n]!='t')
n--;
goto m1n;
m2n:;
fclose(file);
//for(i=1;i<=p;i++)printf("%c",P<i>);printf("\n");
//for(i=1;i<=n;i++)printf("%c",N<i>);printf("\n");
//printf("%i include-pairs %i nucleotides %i proteins\n",f,n,p);
//------------1st line------------------ B<i> = result
m=0;
for(i=1;i<=p;i++){
n1=T[N[i*3-2]]*16+T[N[i*3-1]]*4+T[N[i*3]];
n2=T[N[i*3+1]]*16+T[N[i*3+2]]*4+T[N[i*3+3]];
//printf("\ni=%i p=%i n1=%i n2=%i\n",i,p,n1,n2);
if(E[n1][n2]<1 || G[P<i>]==G[P[i+1]] /* || i==n */){
printf("%c",P<i>);
m++;
B[m]=P<i>;
goto m3;
printf("(%c%c)",P<i>,P[i+1]);
i++;
m++;
B[m]='(';
m++;
B[m]=P[i-1];
m++;
B[m]=P<i>;
m++;
B[m]=')';
//printf("(%c)%c",G[A<i>],G[A[i+1]]);i++;
m3:;
printf("\n");
//------------2nd line------------------ C<i> = result
m=0;
for(i=1;i<=p;i++){
n1=T[N[i*3-2]]*16+T[N[i*3-1]]*4+T[N[i*3]];
n2=T[N[i*3+1]]*16+T[N[i*3+2]]*4+T[N[i*3+3]];
if(E[n1][n2]<1 || G[P<i>]==G[P[i+1]] /* || i==n */){
printf("%c",P<i>);
m++;
C[m]=P<i>;
goto m4;
printf("(%c%c)",G[P<i>],G[P[i+1]]);
i++;
m++;
C[m]='(';
m++;
C[m]=G[P[i-1]];
m++;
C[m]=G[P<i>];
m++;
C[m]=')';
//printf("(%c)%c",G[A<i>],G[A[i+1]]);i++;
m4:;
printf("\n");
//for(i=1;i<=m;i++)printf("%c",B<i>);printf("\n");
//------------3rd line------------------ printf only
m=0;
for(i=1;i<=p;i++){
n1=T[N[i*3-2]]*16+T[N[i*3-1]]*4+T[N[i*3]];
n2=T[N[i*3+1]]*16+T[N[i*3+2]]*4+T[N[i*3+3]];
if(E[n1][n2]<1 || G[P<i>]==G[P[i+1]] /* || i==n */){
printf("%c%c%c",N[i*3-2],N[i*3-1],N[i*3]);
goto m33;
printf("(%c%c%c%c%c%c)",N[i*3-2],N[i*3-1],N[i*3],N[i*3+1],N[i*3+2],N[i*3+3]);
i++;
m33:;
printf("\n");
//--------------substrings------------
substrings(20,29);
substrings(30,39);
substrings(40,49);
substrings(50,59);
substrings(60,69);
return 0;
int substrings(int x1,int x2)
printf("\n");
printf("lengths %i - %i : \n",x1,x2);
for(i=1; i<p; i++)
for (j=i+x1; j<i+x2; j++) {
if (C<i>>95 && C[j]>95) { // if lc letter in line2
for(x=i;x<=j;x++)
printf("%c",C[x]);
printf("|");
for(x=i;x<=j;x++)
if(B[x]>44) // if not () in line 1
printf("%c",B[x]);
printf("|");
for(x=i;x<=j;x++)
if(C[x]>95) // if lc letter line2
printf("%c",C[x]);
printf("\n");}
input file1.txt
MKKHTDQPIADVQGSPDTRH
IAIDRVGIKAIRHPVLVADK
DGGSQHTVAQFNMYVNLPHN
FKGTHMSRFVEILNSHEREI
SVESFEEILRSMVSRLESDS
GHIEMTFPYFVNKSAPISGV
KSLLDYEVTFIGEIKHGDQY
GFTMKVIVPVTSLCPCSKKI
SDYGAHNQRSHVTISVHTNS
FVWIEDVIRIAEEQASCELF
GLLKRPDEKYVTEKAYNNPK
FVEDIVRDVAEILNHDDRID
AYVVESEBFESIHNHSAYAL
IERD
input file2.txt
atgaaaaaacatactgatcaacctatcgctgatgtgcagggctcaccggataccagacat
atcgcaattgacagagtcggaatcaaagcgattcgtcacccggttctggtcgccgataag
gatggtggttcccagcataccgtggcgcaatttaatatgtacgtcaatctgccacataat
ttcaaagggacgcatatgtcccgttttgtggagatactaaatagccacgaacgtgaaatt
tcggttgaatcatttgaagaaattttgcgctccatggtcagcaggctggaatcagattcc
ggccatattgaaatgacttttccctacttcgtcaataaatcagcccctatctcaggtgta
aaaagcttgctggattatgaggtaacctttatcggcgaaattaaacatggcgatcaatat
gggtttaccatgaaggtgatcgttcctgttaccagcctgtgcccctgctccaagaaaata
tccgattacggtgcgcataaccagcgttcacacgtcaccatttctgtacacactaacagc
ttcgtctggattgaggacgttatcagaattgcggaagaacaggcctcatgcgaactgttc
ggtctgctgaaacggccggatgaaaaatatgtcacagaaaaggcctataacaatccgaaa
tttgtcgaagatatcgtccgtgatgtcgccgaaatacttaatcatgatgaccggatagat
gcctatgttgttgaatcagaaaactttgaatccatacataatcactctgcatacgcactg
atagagcgcgac
input file3.txt
FA tttgcc
FA ttcgcc
FA tttgct
FA ttcgct
LK ttaaaa
LK ttgaaa
LK ttaaag
LK ttgaag
LS ctgctc
LS ctgctt
LS ctactc
LS ctactt
LT ctcacc
LT ctcact
LT cttacc
LT cttact
LY ctctac
LY ctctat
LY ctttac
LY ctttat
LG ctcggc
LG ctcggt
LG cttggc
LG cttggt
IP attccc
IP attcct
IP atcccc
IP atccct
IP attcca
IP attccg
IP atccca
IP atcccg
ML atgctc
ML atgctt
ML atgctc
ML atgctt
VL gtgctg
VL gtgcta
VL gtactg
VL gtacta
VS gtgtcc
VS gtatct
VS gtgtcc
VS gtatct
VT gtcacc
VT gtcact
VT gttacc
VT gttact
VS gtcagc
VS gtcagt
VS gttagc
VS gttagt
SL tcgctg
SL tcgcta
SL tcactg
SL tcacta
SP tctcca
SP tctccg
SP tcccca
SP tccccg
PV ccggtg
PV ccggta
PV ccagtg
PV ccagta
PG cccggc
PG cccggt
PG cctggc
PG cctggt
TL acgctg
TL acgcta
TL acactg
TL acacta
TP acgccg
TP acgcca
TP acaccg
TP acacca
AL gcttta
AL gctttg
AL gcctta
AL gccttg
AP gcgccg
AP gcgcca
AP gcaccg
AP gcacca
AP gctcca
AP gctccg
AP gcccca
AP gccccg
AN gctaat
AN gctaac
AN gccaat
AN gccaac
AS gccagc
AS gccagt
AS gctagc
AS gctagt
YP tatccg
YP tatcca
YP tacccg
YP taccca
HP catccg
HP catcca
HP cacccg
HP caccca
QR cagcga
QR cagcgg
QR caacga
QR caacgg
DL gatttg
DL gattta
DL gacttg
DL gactta
EN gaaaat
EN gaaaac
EN gagaat
EN gagaac
EK gaaaaa
EK gaaaag
EK gagaaa
EK gagaag
ER gagcga
ER gagcgg
ER gaacga
ER gaacgg
WR tggcga
WR tggcgg
RV cgggtg
RV cgggta
RV cgagtg
RV cgagta
RW cggtgg
RW cgatgg
SG agtgga
SG agtggg
SG agcgga
SG agcggg
GF ggtttt
GF ggtttc
GF ggcttt
GF ggcttc
GL gggctg
GL gggcta
GL ggactg
GL ggacta
GY gggtat
GY gggtac
GY ggatat
GY ggatac
GY ggttat
GY ggttac
GY ggctat
GY ggctac
GK ggaaaa
GK ggaaag
GK gggaaa
GK gggaag
GK ggcaag
GK ggcaaa
GK ggtaag
GK ggtaaa
GW ggctgg
GW ggttgg
GR gggcgg
GR gggcga
GR ggacgg
GR ggacga
GS ggcagc
GS ggcagt
GS ggtagc
GS ggtagt
output fileout.txt
MKKHTDQPIADVQGSPDTRHIAIDRVGIKAIR(HP)VLVADKDGGSQHTVAQFNMYVNLPHNFKGTHMSRFVEILNSHEREISVESFEEILRSM(VS)RLESDSGHIEMTFPYFVNKSAPISGVKSLLDYEVTFIGEIKHGDQYGFTMKVIVP(VT)SLCPCSKKISDYGAHNQRSH(VT)ISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPD(EK)YVT(EK)AYNNPKFVEDIVRDVAEILNHDDRIDAYVVES(EF)ESIHNHSAYALIERD
MKKHTDQPIADVQGSPDTRHIAIDRVGIKAIR(dp)VLVADKDGGSQHTVAQFNMYVNLPHNFKGTHMSRFVEILNSHEREISVESFEEILRSM(st)RLESDSGHIEMTFPYFVNKSAPISGVKSLLDYEVTFIGEIKHGDQYGFTMKVIVP(st)SLCPCSKKISDYGAHNQRSH(st)ISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPD(dt)YVT(dt)AYNNPKFVEDIVRDVAEILNHDDRIDAYVVES(dp)ESIHNHSAYALIERD
atgaaaaaacatactgatcaacctatcgctgatgtgcagggctcaccggataccagacatatcgcaattgacagagtcggaatcaaagcgattcgt(cacccg)gttctggtcgccgataaggatggtggttcccagcataccgtggcgcaatttaatatgtacgtcaatctgccacataatttcaaagggacgcatatgtcccgttttgtggagatactaaatagccacgaacgtgaaatttcggttgaatcatttgaagaaattttgcgctccatg(gtcagc)aggctggaatcagattccggccatattgaaatgacttttccctacttcgtcaataaatcagcccctatctcaggtgtaaaaagcttgctggattatgaggtaacctttatcggcgaaattaaacatggcgatcaatatgggtttaccatgaaggtgatcgttcct(gttacc)agcctgtgcccctgctccaagaaaatatccgattacggtgcgcataaccagcgttcacac(gtcacc)atttctgtacacactaacagcttcgtctggattgaggacgttatcagaattgcggaagaacaggcctcatgcgaactgttcggtctgctgaaacggccggat(gaaaaa)tatgtcaca(gaaaag)gcctataacaatccgaaatttgtcgaagatatcgtccgtgatgtcgccgaaatacttaatcatgatgaccggatagatgcctatgttgttgaatca(gaaaac)tttgaatccatacataatcactctgcatacgcactgatagagcgc
lengths 20 - 29 :
st)SLCPCSKKISDYGAHNQRSH(s|VTSLCPCSKKISDYGAHNQRSHV|sts
st)SLCPCSKKISDYGAHNQRSH(st|VTSLCPCSKKISDYGAHNQRSHVT|stst
t)SLCPCSKKISDYGAHNQRSH(s|TSLCPCSKKISDYGAHNQRSHV|ts
t)SLCPCSKKISDYGAHNQRSH(st|TSLCPCSKKISDYGAHNQRSHVT|tst
lengths 30 - 39 :
st)ISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPD(d|VTISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPDE|std
t)ISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPD(d|TISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPDE|td
t)ISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPD(dt|TISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPDEK|tdt
dt)AYNNPKFVEDIVRDVAEILNHDDRIDAYVVES(d|EKAYNNPKFVEDIVRDVAEILNHDDRIDAYVVESE|dtd
dt)AYNNPKFVEDIVRDVAEILNHDDRIDAYVVES(dp|EKAYNNPKFVEDIVRDVAEILNHDDRIDAYVVESEF|dtdp
t)AYNNPKFVEDIVRDVAEILNHDDRIDAYVVES(d|KAYNNPKFVEDIVRDVAEILNHDDRIDAYVVESE|td
t)AYNNPKFVEDIVRDVAEILNHDDRIDAYVVES(dp|KAYNNPKFVEDIVRDVAEILNHDDRIDAYVVESEF|tdp
lengths 40 - 49 :
st)ISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPD(dt)YVT(d|VTISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPDEKYVTE|stdtd
st)ISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPD(dt)YVT(dt|VTISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPDEKYVTEK|stdtdt
t)ISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPD(dt)YVT(d|TISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPDEKYVTE|tdtd
t)ISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPD(dt)YVT(dt|TISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPDEKYVTEK|tdtdt
dt)YVT(dt)AYNNPKFVEDIVRDVAEILNHDDRIDAYVVES(d|EKYVTEKAYNNPKFVEDIVRDVAEILNHDDRIDAYVVESE|dtdtd
dt)YVT(dt)AYNNPKFVEDIVRDVAEILNHDDRIDAYVVES(dp|EKYVTEKAYNNPKFVEDIVRDVAEILNHDDRIDAYVVESEF|dtdtdp
t)YVT(dt)AYNNPKFVEDIVRDVAEILNHDDRIDAYVVES(d|KYVTEKAYNNPKFVEDIVRDVAEILNHDDRIDAYVVESE|tdtd
t)YVT(dt)AYNNPKFVEDIVRDVAEILNHDDRIDAYVVES(dp|KYVTEKAYNNPKFVEDIVRDVAEILNHDDRIDAYVVESEF|tdtdp
lengths 50 - 59 :
t)RLESDSGHIEMTFPYFVNKSAPISGVKSLLDYEVTFIGEIKHGDQYGFTMKVIVP(s|SRLESDSGHIEMTFPYFVNKSAPISGVKSLLDYEVTFIGEIKHGDQYGFTMKVIVPV|ts
lengths 60 - 69 :
dp)VLVADKDGGSQHTVAQFNMYVNLPHNFKGTHMSRFVEILNSHEREISVESFEEILRSM(s|HPVLVADKDGGSQHTVAQFNMYVNLPHNFKGTHMSRFVEILNSHEREISVESFEEILRSMV|dps
dp)VLVADKDGGSQHTVAQFNMYVNLPHNFKGTHMSRFVEILNSHEREISVESFEEILRSM(st|HPVLVADKDGGSQHTVAQFNMYVNLPHNFKGTHMSRFVEILNSHEREISVESFEEILRSMVS|dpst
p)VLVADKDGGSQHTVAQFNMYVNLPHNFKGTHMSRFVEILNSHEREISVESFEEILRSM(s|PVLVADKDGGSQHTVAQFNMYVNLPHNFKGTHMSRFVEILNSHEREISVESFEEILRSMV|ps
p)VLVADKDGGSQHTVAQFNMYVNLPHNFKGTHMSRFVEILNSHEREISVESFEEILRSM(st|PVLVADKDGGSQHTVAQFNMYVNLPHNFKGTHMSRFVEILNSHEREISVESFEEILRSMVS|pst
st)RLESDSGHIEMTFPYFVNKSAPISGVKSLLDYEVTFIGEIKHGDQYGFTMKVIVP(st|VSRLESDSGHIEMTFPYFVNKSAPISGVKSLLDYEVTFIGEIKHGDQYGFTMKVIVPVT|stst
st)SLCPCSKKISDYGAHNQRSH(st)ISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPD(d|VTSLCPCSKKISDYGAHNQRSHVTISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPDE|ststd
st)SLCPCSKKISDYGAHNQRSH(st)ISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPD(dt|VTSLCPCSKKISDYGAHNQRSHVTISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPDEK|ststdt
t)SLCPCSKKISDYGAHNQRSH(st)ISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPD(d|TSLCPCSKKISDYGAHNQRSHVTISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPDE|tstd
t)SLCPCSKKISDYGAHNQRSH(st)ISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPD(dt|TSLCPCSKKISDYGAHNQRSHVTISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPDEK|tstdt
t)SLCPCSKKISDYGAHNQRSH(st)ISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPD(dt)YVT(d|TSLCPCSKKISDYGAHNQRSHVTISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPDEKYVTE|tstdtd
Edited by: David Halitsky on Mar 18, 2008 4:21 AM
Edited by: David Halitsky on Mar 18, 2008 4:22 AM
Maybe you are looking for
-
Hi Folks, I am trying to create a Execute a DTP,for which the data is coming from a cube. All Transformations are active and after executing the DTP,i'm facing the below mentioned errors: Error while updating to target ZPOP_CHA (type INFOCUBE)
-
Authentication error while consuming web service published in SR of CE 7.1
Hi, I am having this error while trying to consume a web service published in local services registry. Authentication level is set as Basic in the web service and in end point. I am receiving this error in security log files. Message:Authentication f
-
HP Update unable to install HP Printer Diagnostic Tools
Today the HP Update application prompted me to install three updates related to my Deskjet 3520. Two of them seemingly installed OK, but the third one ("HP Printer Diagnostic Tools") downloads but immediately fails after installation has started. The
-
How do I create a Username Validator for a web service.
I'm trying to figure out how to create a Username validator. I've followed the WSIT documentation and created their calculator service. The service works when I leave security turned off, so I know I'm good up to this point. I right click on the Web
-
Just purchased adobe pdf pack, unable to make pdf files
just purchased adobe pdf pack unable to make pdf files