Logical AND in Java Regular Expressions

I'm trying to implement logical AND using Java Regular Expressions.
I couldn't figure out how to do it after reading Java docs and textbooks. I can do something like "abc.*def", which means that I'm looking for strings which have "abc", then anything, then "def", but it is not "pure" logical AND - I will not find "def.*abc" this way.
Any ideas, how to do it ?
Baken

First off, looks like you're really talking about an "OR", not an "AND" - you want it to match abc.*def OR def.*abc right? If you tried to match abc.*def AND def.*abc nothing would ever match that, as no string can begin with both "abc" and "def", just like no numeric value can be both 2 and 5.
Anyway, maybe regex isn't the right tool for this job. Can you not simply programmatically match it yourself using String methods? You want it to match if the string "starts with" abc and "ends with" def, or vice-versa. Just write some simple code.

Similar Messages

  • SQL Injection and Java Regular Expression: How to match words?

    Dear friends,
    I am handling sql injection attack to our application with java regular expression. I used it to match that if there are malicious characters or key words injected into the parameter value.
    The denied characters and key words can be " ' ", " ; ", "insert", "delete" and so on. The expression I write is String pattern_str="('|;|insert|delete)+".
    I know it is not correct. It could not be used to only match the whole word insert or delete. Each character in the two words can be matched and it is not what I want. Do you have any idea to only match the whole word?
    Thanks,
    Ricky
    Edited by: Ricky Ru on 28/04/2011 02:29

    Avoid dynamic sql, avoid string concatenation and use bind variables and the risk is negligible.

  • Java – Regular Expressions – Finding any non digit byte in a multiple byte

    Hello,
    I’m new to JAVA and Regular Expressions; I’m trying to write a regular expression that will find any records that contain a non digit byte in a multiple byte field.
    I thought the following was the correct expression but it is only finding records that contain “all” non digit bytes.
    \D{1,}
    \D = Non Digit
    {1,} = at least 1 or more
    Below is my sample data. I would like the regular expression to find all of the records that are not all numeric. However when I use the regular expression \D{1,} it is only finding the 2 records that all bytes are non digits. (i.e. “ “ and “A “)
    “ 111229”
    “2 111229”
    “20091229”
    “200912c9”
    “201#1229”
    “20101229”
    “20110229”
    “20111*29”
    “20111029”
    “20111229”
    “20B11229”
    “A “
    “A0111229”
    Please note I have also tried \D{1,}+ and \D{1,}? And they also do not return my desired results
    Any assistance someone can provide would be greatly appreciated.

    You don't show the code you are using but I surmise you are using String.matches() which requires that the whole target must match the regular expression not just part of it. Instead you should create a Pattern and then a Matcher and use the Matcher.find() method. Check the Javadoc for Pattern and Matcher and look at the Java regex tutorial - http://docs.oracle.com/javase/tutorial/essential/regex/ .
    P.S. You can re-use the Pattern object - you don't have to create it every time you need one.
    P.P.S. Java regular expressions work with characters not bytes and characters are not not not bytes.

  • Java Regular Expressions in J2EE

    Does anybody know when Java Regular Expressions will be available in J2EE. They are currently in the latest release of J2SE in the java.util.regex package.

    They are in the Standard Edition, so it does not make sense that they will also be in Enterprise Edition some day. You need to have the standard JRE installed before you can use the J2EE classes anyway.
    If you want to use the regular expressions, install version 1.4 (beta) of the J2SE and use the current version of J2EE on top of that.
    Jesper

  • Problems with java regular expressions

    Hi everybody,
    Could someone please help me sort out an issue with Java regular expressions? I have been using regular expressions in Python for years and I cannot figure out how to do what I am trying to do in Java.
    For example, I have this code in java:
    import java.util.regex.*;
    String text = "abc";
              Pattern p = Pattern.compile("(a)b(c)");
              Matcher m = p.matcher(text);
    if (m.matches())
                   int count = m.groupCount();
                   System.out.println("Groups found " + String.valueOf(count) );
                   for (int i = 0; i < count; i++)
                        System.out.println("group " + String.valueOf(i) + " " + m.group(i));
    My expectation is that group 0 would capture "abc", group 1 - "a" and group 2 - "c". Yet, I I get this:
    Groups found 2
    group 0 abc
    group 1 a
    I have tried other patterns and input text but the issue remains the same: no matter what, I cannot capture any paranthesized expression found in the pattern except for the first one. I tried the same example with Jakarta Regexp 1.5 and that works without any problems, I get what I expect.
    I am using Java 1.5.0 on Mac OS X 10.4.
    Thank to all who can help.

    paulcw wrote:
    If the group count is X, then there are X plus one groups to go through: 0 for the whole match, then 1 through X for the individual groups.It does seem confusing that the designers chose to exclude the zero-group from group count, but the documentation is clear.
    Matcher.groupCount():
    Group zero denotes the entire pattern by convention. It is not included in this count.

  • Perl Regular expression to java Regular Expression

    HI all,
    How can i write java Regular expression for the below Perl Code
    where data.html is my original Html file
    and data2.html is output file.
    open(FPR, "data.html") || die("Could not open data file");
    while ($line=<FPR>) {
    $content .= $line;
    close(FPR);
    open(FPR, ">data2.html") || die("Could not open data2 file");
    # clean white spaces
    $content =~ s/[\n\r\0 ]//g;
    # divide data by td
    $rxp='<tr.*?><td.*?>(.*?)<\/.*?td><td.*?>(.*?)<\/.*?td><td.*?>(.*?)<\/.*?td><td.*?>(.*?)<\/.*?td><td.*?>(.*?)<\/.*?td><td.*?>(.*?)<\/.*?td><td.*?>(.*?)<\/.*?td><td.*?>(.*?)<\/.*?td><\/.*?tr>';
    while ($content=~ m/$rxp/g)
    print FPR "\n".$1."\t".$2."\t".$3."\t".$4."\t".$5."\t".$6."\t".$7."\t".$8."\t";
    print FPR "<br>";
    close(FPR);
    can you help in this regard
    Thanks

    I am able to retrive only one row in this format from data.html file
    <trvalign=middlebordercolor=#ffffff><tdwidth='40'CLASS='tdbgpricespagecolorgrey'><fontface='Arial,Helvetica,sans-serif'size='2'>SB</font></td><t
    dwidth="23"Class=tdbgpricespagecolorgrey><fontface='Arial,Helvetica,sansserif'size='2'>USAirways</font></td><tdwidth="34"Class=tdbgpricespagecolorgrey><fontface='Arial,Helvetica,sans-serif'size='2'>MIA</font></td><tdwidth="31"Class=tdbgpri
    cespagecolorgrey><fontface='Arial,Helvetica,sans-erif'size='2'>LGW</font></td><tdwidth="23"Class=tdbgpricespagecolorgrey><fontface='Arial,Helvetica,sans-serif'size='2'>USAirways</font></td><tdwidth="34"Class=tdbgpricespagecolorgrey><fontface='Arial,Helvetica,sans-serif'size='2'>LGW</font></td>
    But i need the output in this format
    <fontface='Arial,Helvetica,sans-serif'size='2'>SB     <fontface='Arial,Helvetica,sans-serif'size='2'>USAirways     <fontface='Arial,Helvetica,sans-serif'size='2'>MIA     <fontface='Arial,Helvetica,sans-serif'size='2'>LGW     <fontface='Arial,Helvetica,sans-serif'size='2'>USAirways     <fontface='Arial,Helvetica,sans-serif'size='2'>LGW     <fontface='Arial,Helvetica,sans-serif'size='2'>MIA          <br>
    <fontface='Arial,Helvetica,sans-serif'size='2'>CS     <fontface='Arial,Helvetica,sans-serif'size='2'>USAirways     <fontface='Arial,Helvetica,sans-serif'size='2'>MIA     <fontface='Arial,Helvetica,sans-serif'size='2'>LON     <fontface='Arial,Helvetica,sans-serif'size='2'>USAirways     <fontface='Arial,Helvetica,sans-serif'size='2'>LON     <fontface='Arial,Helvetica,sans-serif'size='2'>MIA          <br>
    How can i rewrite the code to achive this.
    Here is my java code
    import java.io.*;
    import java.util.*;
    import java.util.regex.*;
    public class parseHTML {
    public static void main(String[] args)
    try
    BufferedReader in = new BufferedReader(new FileReader("C:\\data.html"));
    PrintWriter out = new PrintWriter(new FileWriter("C:\\data1.html"));
    String aLine = null;
    String abc=null;
    String pattern1 ="<tr.+?><td.+?>(.+?)</.+?td><td.+?>(.+?)</.+?td><td.+?>(.+?)</.+?td><td.+?>(.+?)</.+?td><td.+?>(.+?)</.+?td><td.+?>(.+?)</.+?td><td.+?>(.+?)</.+?td><td.+?>(.+?)</.+?td><td.+?>(.+?)</.+?td><td.+?>(.+?)</.+?td><td.+?>(.+?)</.+?td>++";
    Pattern p1 = Pattern.compile(pattern1);
    while((aLine = in.readLine()) != null)
    abc=aLine.replaceAll("(\n|\t|\r)","").replaceAll(" ","");
    Matcher m1 = p1.matcher(abc);
    if(m1.find())
    System.out.println("the value is...."+m1.group());
    out.print(m1.group());
    m1.reset(aLine);
    in.close();
    out.close();
    catch(IOException exception)
    exception.printStackTrace();
    Thanks

  • Improving Java Regular Expression Compile Time

    Hi,
    Just wondering if anyone here knows how can i improve the compile time of Java Regular Expression?
    The following is fragment of my code which I tired to see the running time.
    Calendar rightNow = Calendar.getInstance();
    System.out.println("Compile Pattern");
    startCompileTime = rightNow.getTimeInMillis();
    Pattern p = Pattern.compile(reg, Pattern.CASE_INSENSITIVE);
    rightNow = Calendar.getInstance();
    endCompileTime = rightNow.getTimeInMillis();
    Below is fragment of my regular expression:
    (?:tell|state|say|narrate|recount|spin|recite|order|enjoin|assure|ascertain|demonstrate|evidence|distinguish|separate|differentiate|secern|secernate|severalize|tell apart) me (?:about|abou|asti|approximately|close to|just about|some|roughly|more or less|around|or so|almost|most|all but|nearly|near|nigh|virtually|well-nigh) java
    My regular expression is a very long one and the Pattern.compile just take too long. The worst case that I experience is 2949342 milliseconds.
    Any idea how can I optimise my regular expression so that the compilation time is acceptable.
    Thanks in advance

    My regular expression is a very long one and the
    Pattern.compile just take too long. The worst case
    that I experience is 2949342 milliseconds.Wow, that's pretty pathological. I was going to tell you that you were measuring something wrong, because I had written a test program that could compile a 1 Mb "or" pattern (10,000 words, 100 bytes per) in under 200 ms ... but then I noticed that your patterns have two "or" components, so reran my test, and got over 14 seconds to run with a smaller pattern.
    My guess is that the RE compiler, rather than decomposing the RE into a tree, is taking the naive approach of translating it into a state machine, and replicating the second component for each path through the first component.
    If you can create a simple hand-rolled parser, that may be your best option. However, it appears that your substrings aren't easily tokenized (some include spaces), so your best bet is to break the regexes into pieces at the "or" constructs, and use Pattern.split() to apply each piece sequentially.
    import java.util.Random;
    import java.util.regex.Pattern;
    public class RegexTest
        public static void main(String[] argv) throws Exception
            long initial = System.currentTimeMillis();
            String[] words = generateWords(10000);
    //        String patStr = buildRePortion(words);
    //        String patStr = buildRePortion(words) + " xxx ";
            String patStr = buildRePortion(words) + " xxx " + buildRePortion(words);
            long startCompile = System.currentTimeMillis();
            Pattern pattern = Pattern.compile(patStr, Pattern.CASE_INSENSITIVE);
            long finishCompile = System.currentTimeMillis();
            System.out.println("Number of components = " + words.length);
            System.out.println("ms to create pattern = " + (startCompile - initial));
            System.out.println("ms to compile        = " + (finishCompile - startCompile));
        private final static String[] generateWords(int numWords)
            String[] results = new String[numWords];
            Random rnd = new Random();
            for (int ii = 0 ; ii < numWords ; ii++)
                char[] word = new char[20];
                for (int zz = 0 ; zz < word.length ; zz++)
                    word[zz] = (char)(65 + rnd.nextInt(26));
                results[ii] = new String(word);
            return results;
        private static String buildRePortion(String[] words)
            StringBuffer sb = new StringBuffer("(?:");
            for (int ii = 0 ; ii < words.length ; ii++)
                sb.append(ii > 0 ? "|" : "")
                  .append(words[ii]);
            sb.append(")");
            return sb.toString();
    }

  • Java regular expression for CSV?

    I found several regular expressions in the internet to parse/split csv data lines. Howeverm, they all don't work with the Java regular expression API. Is there a regular expression to tokenize CSV fields for the Java regexp API?

    If the licensing of the above solution is too restrictive for you...I'm sure there are other types of parsers out there that do that type of thing.
    In the meantime, here is some code I cooked up (no GPL...use it freely) that might get you started.
    Don't know that it handles everything, but I never said it would...
    Please READ and let me know what changes could be made. I'm always looking for improvements in my understanding of regular expressions...
    import java.util.regex.*;
    import java.util.*;
    import java.util.List;
    public class Example
       final static Pattern CSV_PATTERN;
       final static Pattern DOUBLE_QUOTE;
       static
          String regex = "(?:  ([^q;]+) | (?: q ((?: (?:[^q]+) | (?:qq) )+ ) q)  );?";
          //                       1          2          a           b       3    4
          // So, pretend your quote character is q
          // (you can change it to \" later when you understand what's going on.)
          // This regex (when applied iteravely) matches a token that:
          // 1) contains NO QUOTE MARKS whatsoever (;'s) (in group 1)
          //                       or
          // 2) starts with a QUOTE, then contains either
          //    a) no quotes at all inside or
          //    b) double quotes (to escape a quote)
          // 3) and ends with a QUOTE.
          // 4) and is followed by a separator (optional for the last value)
          // Note that (a) and (b) are captured in group 2 of the regex.
          CSV_PATTERN = Pattern.compile(regex, Pattern.COMMENTS);
          DOUBLE_QUOTE = Pattern.compile("qq");
        * Attempts to parse Excel CSV stuff...
        * @param text the CSV text.
        * @return a list of tokens.
       public static List parseCsv(String text)
          Matcher csvMatcher = CSV_PATTERN.matcher(text);
          Matcher doubleQuotes = DOUBLE_QUOTE.matcher("");
          List list = new ArrayList();
          while (csvMatcher.find())
             if (csvMatcher.group(1) != null)
                // The first one matched.
                list.add(csvMatcher.group(1));
             else
                doubleQuotes.reset(csvMatcher.group(2));
                list.add(doubleQuotes.replaceAll("q"));
          return list;
    }

  • Java regular expression for Arabic

    i want to use java regular expression to evaluate some string in Arabic
    can some body tell me how to do a match for arabic characters

    i have this code :
    String poem="���";
          //String m1="\\p?";   
           String m1= "\\p{�}";
            Matcher m =
          Pattern.compile(m1)
            .matcher(poem);
        while(m.find()) {
          for(int j = 0; j <= m.groupCount(); j++)
            System.out.print("[" + m.group(j) + "]");
          System.out.println();
        }i get the error:
    Exception java.util.regex.PatternSyntaxException: Unknown character property name {?} near index 2
    \p?
    if you find that is hard to help with Arabic regex, can someone post a code on how to match Arabic regex or chineese or any thing not latin regex match
    because a need to match a Strings in Arabic if some one can tell me how?

  • Java Regular Expressions and Pattern

    I have a file that i first want to get all the lines that match a given pattern. Then from these lines that match i want to extract two values.
    Example line for the pattern to match
    INFO | jvm 1 | 2006/11/07 15:14:09 | INFO | Tue Nov 07 15:14:09 CET 2006 | XLDB PPS Data Dumper: MESSAGE:- 406 Processing .. '[ /opt/nexus/horizon/raw_data/network/pp_CE01S4H_sta_20050703T015717_SYDP3001_546.bdf ]'
    So all the lines that are like these i want to extract two variables
    2006/11/07 15:14:09
    and
    /opt/nexus/horizon/raw_data/network/pp_CE01S4H_sta_20050703T015717_SYDP3001_546.bdf
    so i can store these variables in a database.
    Can someone help me with writing the pattern to match and the regular express to extract? Also if anyone else has a better way of doing this i am all ears and i have a lot of log files to go through.

    import java.util.regex.*;
    class Main
      public static void main(String[] args)
        String txt="INFO | jvm 1 | 2006/11/07 15:14:09 | INFO | Tue Nov 07 15:14:09 CET 2006 | XLDB PPS Data Dumper: MESSAGE:- 406 Processing .. '[ /opt/nexus/horizon/raw_data/network/pp_CE01S4H_sta_20050703T015717_SYDP3001_546.bdf ]'";
        String re1=".*?";     // Non-greedy match on filler
        String re2="((?:2|1)\\d{3}(?:-|\\/)(?:(?:0[1-9])|(?:1[0-2]))(?:-|\\/)(?:(?:0[1-9])|(?:[1-2][0-9])|(?:3[0-1]))(?:T|\\s)(?:(?:[0-1][0-9])|(?:2[0-3])):(?:[0-5][0-9]):(?:[0-5][0-9]))";     // Time Stamp 1
        String re3=".*?";     // Non-greedy match on filler
        String re4="((?:\\/[\\w\\.]+)+)";     // Unix Path 1
        Pattern p = Pattern.compile(re1+re2+re3+re4,Pattern.CASE_INSENSITIVE | Pattern.DOTALL);
        Matcher m = p.matcher(txt);
        if (m.find())
            String timestamp1=m.group(1);
            String unixpath1=m.group(2);
            System.out.print("("+timestamp1.toString()+")"+"("+unixpath1.toString()+")"+"\n");
    }

  • Help with java regular expressions

    Hi all ,
    i am going to match a patternstring against an input string and print the result here is my code:
         import java.util.regex.*;
         import java.util.*;
         public class Main {
              private static final String CASE_INSENSITIVE = null;
              public static void main(String[] args)
              CharSequence inputStr = "i have 5 years FMCG saLEs exp on java/j2ee and i worked on java and j2ee and 2 projects on telecom java j2ee domain with your  with saLEs maNAger experience of java j2ee and c# having very good  on c++ exposure in JAVA"
             String patternStr = "\"java j2ee\" and \"c#\"";
              StringTokenizer st = new StringTokenizer(patternStr,"\",OR");
             Matcher matcher=null;
              while(st.hasMoreTokens()){
                   String s=st.nextToken();
                   Pattern pattern = Pattern.compile(s,Pattern.CASE_INSENSITIVE);
               matcher = pattern.matcher(inputStr);
               while (matcher.find()) {
                  String result = matcher.group();
                 if(!result.equalsIgnoreCase(" "))
                             System.out.println("result:"+result);
         when i compile this code i am getting the expected result...ie
    result:java j2ee
    result:java j2ee
    result: and
    result: and
    result: and
    result: and
    result: and
    result: and
    result:c#
    but when i replace String patternStr = "\"java j2ee\" and \"c#\""; with
    String patternStr = "\"java j2ee\" and \"c++\""; i am just getting c in the result instead of c++ ie i am getting result :
    result:java j2ee
    result:java j2ee
    result: and
    result: and
    result: and
    result: and
    result: and
    result: and
    result:C
    result:c
    result:c
    result:c
    result:c
    result:c
    result:c
    In the last lines i should get result:c++ instead of result: c
    Any ideas please
    Thanks

    In the last lines i should get result:c++ instead of result: cThe regular expression parser considers the plus sign '+' a special
    character; it means: one or more times the previous regular expression.
    So 'c++' means one or more 'c's on or more times. Obviously you don't
    want that, you want a literal '+' plus sign. You can do that by prepending
    the '+' with a backslash '\'. Unfortunately, the javac compiler considers
    a backslash a special character and therefore you have to 'escape'
    the backslash also, by adding another backslash. The result looks
    like this:"c\\+\\+"kind regards,
    Jos

  • Pattern and Matcher of Regular Expressions

    Hello All,
    MTMISRVLGLIRDQAISTTFGANAVTDAFWVAFRIPNFLRRLFAEGSFATAFVPVFTEVK
    ETRPHADLRELMARVSGTLGGMLLLITALGLIFTPQLAAVFSDGAATNPEKYGLLVDLLR
    LTFPFLLFVSLTALAGGALNSFQRFAIPALTPVILNLCMIAGALWLAPRLEVPILALGWA
    VLVAGALQLLFQLPALKGIDLLTLPRWGWNHPDVRKVLTLMIPTLFGSSIAQINLMLDTV
    IAARLADGSQSWLSLADRFLELPLGVFGVALGTVILPALARHHVKTDRSAFSGALDWGFR
    TTLLIAMPAMLGLLLLAEPLVATLFQYRQFTAFDTRMTAMSVYGLSFGLPAYAMLKVLLP
    I need some help with the regular expressions in java.
    I have encountered a problem on how to retrieve two strings with Pattern and Matcher.
    I have written this code to match one substring"MTMISRVLGLIRDQ", but I want to match multiple substrings in a string.
    Pattern findstring = Pattern.compile("MTMISRVLGLIRDQ");
    Matcher m = findstring.matcher(S);
    while (m.find())
    outputStream.println("Selected Sequence \"" + m.group() +
    "\" starting at index " + m.start() +
    " and ending at index " m.end() ".");
    Any help would be appreciated.

    Double post: http://forum.java.sun.com/thread.jspa?threadID=726158&tstart=0

  • GUI Based tool for search and replace using regular expression

    Hi,
    I have developed this small tool which can be used for search and replace in multiple files using reqular expressions.
    Features:
    1. Full regular expression
    2. GUI based with Highlighted results
    3. Preview for replace available
    4. Pure Java based.
    5. Its like unix sed and grep
    Please visit below site for download/more information :
    http://sourceforge.net/projects/regexsearchrepl/
    Thanks,
    Hitesh Viseria

    I agree with you, it cannot compete grep/sed/awk combination. I couldnt find anything even close to grep/sed for windows which will also have a preview and most important, free. That is what made me write this tool. I am trying to
    improve its performance and more features like history etc.
    Any suggestions on additional features are most welcome.

  • Java Regular Expression.

    I have a document on which i need to extract some information using regular expression. The information needs to be extracted is  "Yogi:   123 − 1456". If i created an expression like
    (?i)Yogi<filler1><Label=DocumentNumber>(<anynumber>) or
    (?i)Yogi<filler1><Label=DocumentNumber>([\d- ]{3,}).. Both expressions doesn't work because the character "−" is a special character. If i just copy paste this sign it works. but when i save my file as xml and try to open this "−"
    sign automatically converted as "?". Kindly let me know if any one of you have solution for this.

    You better ask this in a Java forum. This forum is about the Small Basic programming language.
    Jan [ WhTurner ] The Netherlands

  • Java regular expression patteren.

    Ok can somone help me here. My freind wrote this program in java script and im trying to redo it in java. In one part he uses a regular expression some im trying to do th same thing but i cant gt it, heres what i have so far,
    import java.util.regex.*;
    public class Fred101
        public static void main(String[] args) throws Exception
            final String[] lines =
                "2-03-2007 02:59  [113.219.143.111] installed virus OpenRelay-backdoor.vspam on [localhost]",
                "12-03-2007 02:58 [113.219.143.111] uploaded file OpenRelay-backdoor.vspam(0.003 Gb) to [localhost]",
                "12-03-2007 02:56 admin logged in from []",
                "12-03-2007 02:55 admin logged in from [131.37.190.!]",
                "12-03-2007 02:55 [145.45.125.215] downloaded file Antivirus beta program.av(0.014 Gb) from [localhost]",
                "12-03-2007 02:53 [266.54.36.123] uploaded file Marketing.mailer(0.005 Gb) to [localhost]",
            final Pattern IPPattern = Pattern.compile("( /(25[0-5]|2[0-4][0-9]|[01]?[0-9][0-9]?)\\.(25[0-5]|2[0-4][0-9]|[01]?[0-9][0-9]?)\\.(25[0-5]|2[0-4][0-9]|[01]?[0-9][0-9]?)\\.(25[0-5]|2[0-4][0-9]|[01]?[0-9][0-9]?))");
            for (String line : lines)
                Matcher m = IPPattern.matcher(line);
                while(m.find())
                    System.out.println(m.group());
    }if it worked correctly this should be the out print. AAnyone see whats wrong.
    113.219.143.111
    113.219.143.111
    145.45.125.215

    It almost did i used mainly ur code but i used some of the other guys.
    import java.util.regex.*;
    class main
      public static void main(String[] args)
          final String[] lines =
              "2-03-2007 02:59  [113.219.143.111] installed virus OpenRelay-backdoor.vspam on [localhost]",
              "12-03-2007 02:58 [113.219.143.111] uploaded file OpenRelay-backdoor.vspam(0.003 Gb) to [localhost]",
              "12-03-2007 02:56 admin logged in from []",
              "12-03-2007 02:55 admin logged in from [131.37.190.!]",
              "12-03-2007 02:55 [145.45.125.215] downloaded file Antivirus beta program.av(0.014 Gb) from [localhost]",
              "12-03-2007 02:53 [266.54.36.123] uploaded file Marketing.mailer(0.005 Gb) to [localhost]",
        String re1=".*?";     // Non-greedy match on filler
        String re2="((?:(?:25[0-5]|2[0-4][0-9]|[01]?[0-9][0-9]?)\\.){3}(?:25[0-5]|2[0-4][0-9]|[01]?[0-9][0-9]?))(?![\\d])";     // IPv4 IP Address 1
        Pattern p = Pattern.compile(re1+re2,Pattern.CASE_INSENSITIVE | Pattern.DOTALL);
        //Matcher m = p.matcher(txt);
        for (String line : lines){
             Matcher m = p.matcher(line);
             while(m.find()){
                  String ipaddress1=m.group(1);
                System.out.print("("+ipaddress1.toString()+")"+"\n");
        }which out printed:
    (113.219.143.111)
    (113.219.143.111)
    (145.45.125.215)
    (66.54.36.123)
    see the problem?
    the (66.54.36.123)
    shouldnt bee their because it wasnt a vaild ip. It was originally 266.54.36.123 but since it wasnt balid it made it valid. Which it shouldnt it.
    Message was edited by:
    krrose27

Maybe you are looking for