Translation Pattern Wildcard Match

Our organization uses 5 digit internal extensions throughout. Our CEO would like the ability to dial any 5 digit extension in our organization but wants his caller id to be shown as his name and the extension of his secretary – basically masking his 5 digit extension. I believe the simplest way to achieve this is to create a Translation Pattern, but I’m having an issue trying to match the wildcards in a TP in CUCM7.1.5. At this stage I have set up a new Partition and CSS just for the CEO’s phone and placed a test phone in the new CSS. I then created a TP which is where I run into a problem.
In the TP I have selected the proper partition and in the Calling Party Transformations section I have listed the Calling Party Transform Mask as the secretary extension (we’ll say 55555 for this example). When I use an exact Translation Pattern match (say 12345) the translation works as I would expect (when I dial 12345 from the test phone, the caller ID shows as 55555). However, when I use any wildcards in the Translation Pattern (i.e. XXXXX) the translation does not occur. Now when I dial 12345 the true caller ID number shows instead of the translated number.
I’m basically looking for a catch all rule from the CEO’s phone that will translate to 55555. I’m guessing I’m overlooking something simple here – any assistance? Thanks in advance.

I set up a calling party transformation pattern with the same results. The issue seems to be in matching the dialed pattern or Translation Pattern field. In my testing the pattern is matched only when it's exact and not when wildcards are used. See the first attached screen shot where the pattern is '12345'. When this is applied it works as would be expected and the caller ID on the receiving phone shows 55555. But, on the second attached screenshot using wildcards, when 12345 is dialed the caller ID shows as the number on the phone and not the translated value. For some reason the wildcards don't seem to match.
I've tried various wildcard patterns such as XXXXX, 1234X, and [0-8]XXXX - none work. The last one is the one I'd really like to use. Other thoughts or suggestions?

Similar Messages

Translation pattern not matching

Hello All
I am configuring a cucm 4.2 (yes i know its obsolete) integration with Lync 2010 and am having issues with a translation pattern.
The Lync server is sending me 86xxxxxxxxxx for calls within china and will send 61xxxxxxxx for australia (strips the +)
I have configured a [^86]! which should match any international numbers (other than China) and be prefixed and sent to the gateway. Here is the wiered thing I can dial +44xxxxxxxxxx using my lync client which proves that this is matching (when i delete the translation the call will fail).
But when i dial a number like +61xxxxxxxx it doesnt get through and i get
Cisco CallManagerDigit analysis: match(pi="1",fqcn="", cn="removedbymyself", plv="5", pss="LYNC:PT_Reception", TodFilteredPss="LYNC:PT_Reception", dd="61xxxxxxxx ",dac="0")
Cisco CallManagerDigit analysis: potentialMatches=NoPotentialMatchesExist" on the traces.
The LYNC partition has the translation rules. and the CSS assigned to the sip trunk has access to it. the CSS configured in the translation rules is the also the one assigned to the sip trunk.
Anyone see this sort of thing before? how can i check if there is another transformation taking place?
Only way i get round is to put a translation patter for " ! " and it works for all international calls.
Thanks,

Hi,
Have you tried testing the call with Dialed Number Analyzer? I find that's a fantastic and often-overlooked tool for this kind of issue. If DNA shows the call will not route, it's probably a CSS issue for the Stafford gateway. If DNA shows the call will route, then it's probably a dial-peer issue on the Stafford gateway.
-Jameson

Translation Pattern - X wildcard not working.

I am trying to translate any calls from a certain CSS to extension 4900-4999 to a single extension (8114). I tried using 49XX as the
Translation Pattern, 8114 as the Called Party Transform Mask, and the partiton for this is the first in the CSS list. This is not working...it just calls directly to the dialed extention (4950), but if I change the Translation Pattern to 4950 it works just fine (goes to 8114 like desired). The partition 4950 is located in is halfway down the list in the CSS. Is there a particular reason the X wildcard is not working in this instance?

Everything is working as expected based on your configuration, CUCM uses best match routing.
I can already tell your CSS has access to both, 4950 and 49XX, thus,it's all working fine.
4950 is one match
49XX 100 matches
4950 is the best match.
CSS order only matters when there's 2 or more patterns with the same number of matches. Only THEN, which CSS is on top, will matter.
You need to remove access to the DNs directly and leave only the TP.
HTH
java
if this helps, please rate
www.cisco.com/go/pdihelpdesk

Translation patterns - best practice

We have 300 DIDs from our telco. Currently, only 150 are in use. If a call comes thru for a non-asigned number, I would like to set-up a call handler that states the number is a non-working number that belongs to the company and then give options for contacting the correct person. Also, when a person leaves the company I am currenly forawarding the number to the operator but I would also like to make these numbers part of the call handler.
My question is this - what is the best way to set this up? I currently am removing the number from the directory numbers and setting up a translation pattern to point the number to an end point such as the operator. Is this the best thing to do? I would like to know what is considered to be "best practice" in keeping the phone system as clean as possible.
I appreciate any input.
Pat

I would setup a catch-all scenario with a translation to a CTIRP that would forward to VM and hit the Call handler you desire. For example if you had the DIDs 212-555-1000 thru 212-555-1299 i would first setup a non-DID CTI RP that matches your call handler dtmf (e.g. 7999 if you use 4 digit extensions). the CTI RP for 7999 would forward to VM and then the Call Handler with DTMF of 7999 would play your message that number is not in use.
Then setup a translation for 212-555-1[012]xx that translates to 7999.
This wildcard match would not route the call if there was a more specific match present within the Calling Search Space for the Gateway. So if extension 1050 was present it would route to that phone, but if extension 1051 was a terminated or unused number it would not be present and therefore the call would hit the translation and be routed to the "number not in use" call handler.
I think this is what you are after, a way to minimize the translations and not have to keep track of individual numbers. Of course modify the length of the translations if you are not routing based on 10 digits.

Query About translation pattern

HI ,
we have call manager 8.6 version.
we are planning to implement incoming call blocking based on calling number as we are using MGCP gateway.
we have already implemented +dialing in incoming calls in calling party number.
Query:
will translation pattern pass alphanumeric charactors?
if the matching number starts with alphanumeric charactors (+ ) in translation pattern will translation pattern pass the number or will reject?
Thnaks,

Try this
SELECT ffv.flex_value, maptl.parval
FROM apps.fnd_flex_values ffv,
       (SELECT ffvc.flex_value chval, ffvh.parent_flex_value parval
          FROM apps.fnd_flex_values ffvr1,
               apps.fnd_flex_values ffvr2,
               apps.fnd_flex_values ffvc,
               apps.fnd_flex_value_hier_all ffvh
         WHERE ffvh.child_flex_value_low = ffvr1.flex_value
           AND ffvh.child_flex_value_high = ffvr2.flex_value
           AND ffvc.flex_value_id BETWEEN ffvr1.flex_value_id
                                      AND ffvr2.flex_value_id
           AND ffvr1.flex_value_set_id = :val_set_id
           AND ffvr2.flex_value_set_id = :val_set_id
           AND ffvc.flex_value_set_id = :val_set_id
           AND ffvh.flex_value_set_id = :val_set_id) maptl
WHERE ffv.flex_value = maptl.chval(+)
AND ffv.flex_value_set_id = :val_set_id
ORDER BY ffv.flex_valueThis takes value set id as an input parameter.
HTH

Translation Pattern digit problem

We have created a translation pattern (6925) which allows our users to call an internal number in order for them to get routed out to their external helpdesk via the PSTN (908456016925). Initially this didnt work as the translation patter number of 6925 did not have the correct Calling Search Space to get routed out of the voice gateway.
That is now fixed however every time you dial 6925 you get a dead tone when dialling the number 2. If you press 5 immediately the call routes to the translation pattern and out to the helpdesk. This is not ideal as many users are putting the phone down when they get the dead tone as they think the number is incorrect.
I have checked our dial plan route plan report and can confirm that no other device etc has been allocated a number beginning with 692.
I've also created another translation patter (6935) to the same PSTN number and this works fine ie no dead tone when I dial the digit '3'. In fact I have tested 3,4,5 etc and they are fine its just 692.
Any help would be appreciated.......
BSOC

My first step would be to remove the 6925 translation from CM. Once removed, I would try dialing 6925 to see what happens, knowing full well that it should not work. If there are any other patterns or devices beginning with 69 it should fail after pressing the 2 since there is nothing that matches. I would then add the 6925 translation back in and test again. Let us know!
Tony

Translation Pattern Usage Report

I am trying to determine if a translation pattern is still needed. Is there a report that can be run? Call Manager Release 6.1. Thank you.

Hi,
You can try to check in CDR for the Called Party number (Original and Final) if they match the Translation pattern or the Called Party Transformed number (using Mask or Prefix).
HTH,
Jagpreet Singh Barmi

Need help Creating a translation pattern that adds dial out digits to incoming calls

I came across an article yesterday and it showed the steps how to fix Missed Call/Received Call numbers so that you can dial them from the menu correctly (auto-add a 9, etc.)?
I tried it this morning and came up with this translation pattern:
voice translation-rule 6
rule 1 /^201\(.*\)/ /8\1/
rule 2 /\(..........\)/ /81\1/
voice translation-profile filter_Incoming
translate calling 6
This translation pattern rule 1 adds the dial out character 8 and strips 201 for local calls. Rule 2 adds dial out character 8 and adds 1 for long distance. The purpose of this translation rule is when the ephone receives the phone call the characters 8 and 1 are added so when you quickly need to redial you do not have to edit the number and add 8 for each call.
I tested the translation-rule:
ROUTER-2911#test voice translation-rule 6 9082121231
Matched with rule 2
Original number: 9082121231     Translated number: 819082121231
Original number type: none      Translated number type: none
Original number plan: none      Translated number plan: none
ROUTER-2911#test voice translation-rule 6 2019121231
Matched with rule 1
Original number: 2019121231     Translated number: 89121231
Original number type: none      Translated number type: none
Original number plan: none      Translated number plan: none
ROUTER-2911#
Issue is I am not sure with my inbound call leg if it can even work. We dial out through the SIP Trunk and the incoming is translated to the AutoAttendant on Cisco Unity Express.
voice translation-rule 1
rule 1 /2015552100/ /2003/
voice translation-profile CUE_Voicemail/AutoAttendant
translate called 1
dial-peer voice 9 voip
description **Incoming Call from SIP Trunk**
translation-profile incoming CUE_Voicemail/AutoAttendant
call-block translation-profile incoming BLOCKED-INCOMING
call-block disconnect-cause incoming call-reject
session protocol sipv2
session target dns:nd01-04.fs.SIPPROVIDER.net
incoming called-number .%
voice-class codec 1
voice-class sip dtmf-relay force rtp-nte
dtmf-relay rtp-nte
no vad
Can what I am trying to do be done with my current setup?

Hi patldmart012,
The dial-peer 9 that you have attached will not be affected by following config
voice translation-rule 6
rule 1 /^201\(.*\)/ /8\1/
rule 2 /\(..........\)/ /81\1/
voice translation-profile filter_Incoming
translate calling 6
Because you have not applied the translation profile "filter_incoming" on the dial-peer.
Could you please provide the exact call flow?
Along with that, If you are facing issue with calls on SIP Trunk, please collect following debugs in a logging buffer and attach the file. I will analyse it and will get back to you.
debug voip ccapi inout
debug ccsip message
debug voice translation
Debug h225 asn1 (If H323 involved)
Debug h245 asn1 (If H323 involved)
Debug MGCP Packets (If MGCP involved)
Also provide the running config of the GW.
These are verbose debugs, so please collect them in the following manner:
Router(config)# service sequence
Router(config)# service timestamps debug datetime msec
Router(config)# logging buffered 30000000 7
Router(config)# no logging con
Router(config)# no logging mon
Router# Clear log
Router# term no mon
<Enable debugs, then wait for issue to occur.>
Router# term len 0
<Enable session capture to txt file in terminal program.>
Router# Undebug all
Router# sh log
Once i have the logs, i will analyse it and will get back to you.
Regards,
Mudit Mathur

CDR for translation patterns (DIDs)?

We have some "legacy" DID numbers -- they enter Call Manager where a translation pattern sends them to the current, new number.
Is there someplace the call detail records I can find how often a particular DID (or particular translation pattern) was actually used? If these numbers are no longer in use, we could drop them when we switch carriers in the next month or so.

Although there is no translation information in the CDRs, there is a service parameter which supposedly puts extra information into the traces.
Digit Analysis Complexity : This parameter allows the user to toggle between two modes; that is, StandardAnalysis and TranslationAndAlternatePatternAnalysis. The TranslationAndAlternatePatternAnalysis mode gives information about the Translation pattern and the Alternate matches in the CCM Traces while finding a match for a pattern. The valid values for this field follow:
-- StandardAnalysis
-- TranslationAndAlternatePatternAnalysis
This is a required field.
Default: StandardAnalysis.
Please rate the post if it helps

Translation-pattern delay to outbound call

Hello,
I config one translation-pattern: 1234 tanslation to one mobile number (call ouside to PSTN via E1 link)
and also config T302 time value = 5000 (default 15000)
When I dial 1234, I will get a dial-tone, then waiting 5 second -> the call active.
Is it normally?
Or what could I do to resolve it?
Thanks.

What you are experiencing is expected, this is what is called Inter-digit time out. What is happening is that within your dial plan there is another pattern (could be another Translation Pattern, DN or Route Pattern) starting with "0".
The following Cisco document explains this behavior:
http://www.cisco.com/c/en/us/support/docs/voice-unified-communications/unified-communications-manager-callmanager/6171-interdigit-timeout.html
Now going back to your concern and moving forward with the explanation, the Unified Communications Manager Platform is designed to route calls based on the closest match. When you dial "0" since there is another pattern starting also with 0 in your dial plan then, CUCM will wait for more digits. It is not until the T302 timer (that the document above mentions) expires that CUCM routes the call based on the order of the partitions set or configure on the routing device (in your scenario it is going to be the CSS of the Translation Pattern)
You will be able to check there is an over-lapping pattern within your system by going (in the Administration page for Call Manager) to Call Routing > Route Plan Report and:
1) Type 0 on the search bar and hit search and all the results starting with 0 should display.
Or
2) Exporting your dial plan to a .csv file, open it with excel and apply filters to find the overlapping problem.
You can also reduce the T302 timer from the Call Manager service parameters from the default value (15 seconds) to a minimum of 3 seconds.
Hope this information helps

Call to translation pattern took longer to reach the translated DN

I translated 0 > 9000 which is pilot number for CUACE, noticed when press 0 to dial using particular CSS it's taking a few seconds before the call translated to 9000 and hear the ringing tone.
Which part to check on this?
Thanks

What you are experiencing is expected, this is what is called Inter-digit time out. What is happening is that within your dial plan there is another pattern (could be another Translation Pattern, DN or Route Pattern) starting with "0".
The following Cisco document explains this behavior:
http://www.cisco.com/c/en/us/support/docs/voice-unified-communications/unified-communications-manager-callmanager/6171-interdigit-timeout.html
Now going back to your concern and moving forward with the explanation, the Unified Communications Manager Platform is designed to route calls based on the closest match. When you dial "0" since there is another pattern starting also with 0 in your dial plan then, CUCM will wait for more digits. It is not until the T302 timer (that the document above mentions) expires that CUCM routes the call based on the order of the partitions set or configure on the routing device (in your scenario it is going to be the CSS of the Translation Pattern)
You will be able to check there is an over-lapping pattern within your system by going (in the Administration page for Call Manager) to Call Routing > Route Plan Report and:
1) Type 0 on the search bar and hit search and all the results starting with 0 should display.
Or
2) Exporting your dial plan to a .csv file, open it with excel and apply filters to find the overlapping problem.
You can also reduce the T302 timer from the Call Manager service parameters from the default value (15 seconds) to a minimum of 3 seconds.
Hope this information helps

Pattern and Matcher of Regular Expressions

Hello All,
MTMISRVLGLIRDQAISTTFGANAVTDAFWVAFRIPNFLRRLFAEGSFATAFVPVFTEVK
ETRPHADLRELMARVSGTLGGMLLLITALGLIFTPQLAAVFSDGAATNPEKYGLLVDLLR
LTFPFLLFVSLTALAGGALNSFQRFAIPALTPVILNLCMIAGALWLAPRLEVPILALGWA
VLVAGALQLLFQLPALKGIDLLTLPRWGWNHPDVRKVLTLMIPTLFGSSIAQINLMLDTV
IAARLADGSQSWLSLADRFLELPLGVFGVALGTVILPALARHHVKTDRSAFSGALDWGFR
TTLLIAMPAMLGLLLLAEPLVATLFQYRQFTAFDTRMTAMSVYGLSFGLPAYAMLKVLLP
I need some help with the regular expressions in java.
I have encountered a problem on how to retrieve two strings with Pattern and Matcher.
I have written this code to match one substring"MTMISRVLGLIRDQ", but I want to match multiple substrings in a string.
Pattern findstring = Pattern.compile("MTMISRVLGLIRDQ");
Matcher m = findstring.matcher(S);
while (m.find())
outputStream.println("Selected Sequence \"" + m.group() +
"\" starting at index " + m.start() +
" and ending at index " m.end() ".");
Any help would be appreciated.

Double post: http://forum.java.sun.com/thread.jspa?threadID=726158&tstart=0

How to translate Function text matching to fucntion code?

I try to translate Function text matching to Function code in GUI status?
Is there any way you know how to solve it?

Do you want to get Function code related to function Text in GUI Status programatically?

Translation Pattern for a Route Pattern

I´m trying to make a translation pattern for a route pattern to add a * or a # in the end of the number I'm dialing for example the route pattern is 9.0414XXXXXXX and I want to change to XXXXXXX*. If I dial 904141309131 I see in the phone 4130913*. It seem to be taking a 4 that belong to the 0414 and it is eliminating the las number that in this example is 1. To me the number that I must see when the translation is made is 1309131* and not 4130913*. Is this the way it shoul be done?

Martin,
Did you ever find out how to do this ? I have the same requirement and have tried various transform masks none of which has succeeded.
Thanks in Advance.
Mark.

Pattern and Matching question

Hey,
I'm trying to use the pattern and matcher to replace all instances of a website
address in some html documents as I process them and post them. I'm
including a sample of some of the HTML below and the code I"m using to
process it. For some reason it doesn't replace the sites in the underlying
images and i can't figure out what I'm doing wrong. Please forgive all the
unused variables, those are relics of another way i may have to do this if i
can't get the pattern thing to work.
Josh
     public static void setParameters(File fileName)
          FileReader theReader = null;
          try
               System.out.println("beginning setparameters guide2)");
               File fileForProcessing=new File(fileName.getAbsolutePath());
               //wrap the file in a filereader and buffered reader for maximum processing
               theReader=new FileReader(fileForProcessing);
               BufferedReader bufferedReader=new BufferedReader(theReader);
               //fill in data into the tempquestion variable to be populated
               //Set the question and answer texts back to default
               questionText="";
               answerText="";
               //Define the question variable as a Stringbuffer so new data can be appended to it
               StringBuffer endQuestion=new StringBuffer();//Stringbuffer to store all the lines
               String tempQuestion="";
               //Define new file with the absolutepath and the filename for use in parsing out question/answer data
               tempQuestion=bufferedReader.readLine();//reads the nextline of the question
               String tempAlteredQuestion="";//for temporary alteration of the nextline
               //while there are more lines append the stringbuffer with the new data to complete the question buffer
               StringTokenizer tokenizer=new StringTokenizer(tempQuestion, " ");//tokenizer for reading individual words
               StringBuffer temporaryLine; //reinstantiate temporary line holder each iterration
               String newToken;   //newToken gets the very next token every iterration? changed to tokenizer moretokens loop
               String newTokenTemp;   //reset newTokenTemp to null each iterration
               String theEndOfIt; //string to hold everything after .com
               char[] characters; //character array to hold the characters that are used to hold the entire link
               char lastCharChecked;
               Pattern thePattern=Pattern.compile("src=\"https:////fakesite.com//ics", Pattern.LITERAL);
               Matcher theMatcher=thePattern.matcher(tempQuestion);
                    while(tempQuestion!=null) //every time the tempquestion reads a newline, make sure you aren't at the end
                         String theReplacedString=theMatcher.replaceAll("https:////fakesite.com//UserGuide/");
                         //          temporaryLine=new StringBuffer();
                         //add the temporary line after processed back into the end question.
                         endQuestion.append(theReplacedString);                              //temporaryLine.toString());
                         //reset the tempquestion to the newline that is going to be read
                         tempQuestion=bufferedReader.readLine();
                         if(tempQuestion!=null)
                              theMatcher.reset(tempQuestion);
                         /*newTokenTemp=null;
                         while(tokenizer.hasMoreTokens())
                              newToken=tokenizer.nextToken(); //get the next token from the line for processing
                              System.out.println("uhhhhhh");
                              if(newToken.length()>36) //if the token is long enough chop it off to compare
                                   newTokenTemp=newToken.substring(0, 36);
                              if(newTokenTemp.equals("src=\"https://fakesite.com"));//compare against the known image source
                                   theEndOfIt=new String(); //intialize theEndOfIt
                                   characters=new char[newToken.length()]; //set the arraylength to the length of the initial token
                                   characters=newToken.toCharArray(); //point the character array to the actual characters for newToken
                                   lastCharChecked='a'; // the last character that was compared
                                   int x=0; //setup the iterration variable and go from the length of the whole token back till you find the first /
                                   for(x=newToken.length()-1;x>0&&lastCharChecked!='/';x--)
                                        System.out.println(newToken);
                                        //set last char checked to the lsat iterration run
                                        lastCharChecked=characters[x];
                                        //set the end of it to the last char checked and the rest of the chars checked combined
                                        theEndOfIt=Character.toString(lastCharChecked)+theEndOfIt;
                                   //reset the initial newToken value to the cut temporary newToken root + userguide addin, + the end
                                   newToken=newTokenTemp+"//Userguide"+theEndOfIt;
                              //add in the space aftr the token to the temporary line and the new token, this is where it should be parsed back together
                              temporaryLine.append(newToken+" ");
                         //add the temporary line after processed back into the end question.
                         endQuestion.append(temporaryLine.toString());
                         //reset the tempquestion to the newline that is going to be read
                         tempQuestion=bufferedReader.readLine();
                         //reset tokenizer to the new temporary question
                         if(tempQuestion!=null)
                         tokenizer=new StringTokenizer(tempQuestion);
               //Set the answer to the stringbuffer after converting to string
               answerText=endQuestion.toString();
               //code to take the filename and replace _ with a space and put that in the question text
               char theSpace=' ';
               char theUnderline='_';
               questionText=(fileName.getName()).replace(theUnderline, theSpace);
          catch(FileNotFoundException exception)
               if(logger.isLoggable(Level.WARNING))
               logger.log(Level.WARNING,"The File was Not Found\n"+exception.getMessage()+"\n"+exception.getStackTrace(),exception);
          catch(IOException exception)
               if(logger.isLoggable(Level.SEVERE))
               logger.log(Level.SEVERE,exception.getMessage()+"\n"+exception.getStackTrace(),exception);
          finally
               try
                    if(theReader!=null)
                         theReader.close();
               catch(Exception e)
<SCRIPT language=JavaScript1.2 type=text/javascript></SCRIPT>
<H1><IMG class=img_whs1 height=63 src="https://fakesite.com/ics/header4.jpg" width=816 border=0 x-maintain-ratio="TRUE"></H1>
<H1>Associate Existing Customers</H1>
<P>blahalbalhblabhlab blabhalha blabahbablablabhlablhalhab.<SPAN style="FONT-WEIGHT: bold"><B><IMG class=img_whs2 height=18 alt="Submit a

If you use just / it misinterprets it and it ruins
your " " tags for a string. I don't think so. '/' is not a special character for Java regex, nor for Java String.
The reason i used
literal is to try to force it to directly match,
originally i thought that was the reason it wasn't
working.That will be no problem because it enforces '.' to be treated as a dot, not as a regex 'any character'.
Message was edited by:
hiwa

Translation Pattern Wildcard Match

Similar Messages

Maybe you are looking for