Enhance BW Extractor - coding problems

hi gurus
i need to enhance extractor 0customer_attr so that field from KNKK-GRUPP is pulled in along with 0customer_attr extraction
so i enhance the extractor using append and type it in the data element, PROVIDED zzxyzno in the field name and extracted it and UNHIDE it.
now i wrote below code:
GRUPP
DATA: L_S_INFOSTRU LIKE biw_kna1_s.
CASE I_DATASOURCE.
WHEN '0ustomer_attr'.
DATA: biw_kna1_s_data LIKE biw_kna1_s.
LOOP AT C_T_DATA INTO L_S_INFOSTRU.
L_TABIX = SY-TABIX.
biw_kna1_s_data-ZZXYZNO = KNKK-GRUPP
ENDLOOP.
ENDCASE.
but it is still not pulling in values from extractor...
can you please correct my code ???

thank u sir
can you please give me the correct code?
what needs to be written in Read **
where read needs to be inserted etc. etc.
if u refering some thread can u please give that thread
or let me know !!

Similar Messages

Enhance BW Extractor - Transactional data ABAP CODING ERROR

i need to enhance CRM extractor with additional field.
This is transactional data so i used Exit_rs_001
Here is the extractor result -
Guid...date...........objectid...item guid
1122......1.1.10....901..........8811
1122......2.1.10....901..........8812
1123......1.1.10....902..........8813
1123......2.1.10....902..........8814
now i need field Product id in it which is called from DB Table CRMD_SRV_REFOBJ
itemguid...referencekey...product
8811............01.................110011
8812............02.................110012
8813............03.................110013
now i want to extract data--
Guid...date...........objectid...item guid...product
1122......1.1.10....901..........8811.........110011
1122......2.1.10....901..........8812.........110012
1123......1.1.10....902..........8813.........110013
so i appended the extractor...with field zproduct
FOLLOWING Code doesnot work:::
DATA: L_S_INFOSTRU LIKE ziw_orderma_i.
CASE I_DATASOURCE.
FIELD-SYMBOLS: <PRO_01> TYPE ziw_orderma_i.
CASE i_datasource.
WHEN 'ziw_orderma_i.'. " Upper case
LOOP AT c_t_data ASSIGNING <PRO_01>.
SELECT PRODUCT_ID INTO <PRO_01>-zZPRODUCT
FROM CRMD_SRV_REFOBJ UP TO 1 ROWS
WHERE ITEM_GUID = <PRO_01>-CRMD_SRV_REFOBJ.
ENDSELECT. " not whole primary key
ENDLOOP.
ENDCASE.

actually
coding doesnt give any error
but in output in rsa3 i dont see any data
it worked fine wit the same code for master data datasource in exit...2
now same code different parameters doesnt work in exit..1 for transactional data.

Enhance BW Extractor -abap coding error

hi gurus
i need to enhance extractor 0customer_attr so that field from KNKK-GRUPP is pulled in along with 0customer_attr extraction
so i enhance the extractor using append and type it in the data element, PROVIDED zzxyzno in the field name
Activated it and UNHIDE it.
now my abap code in CMOD in ZXRSAU01 for EXIT RS*01 DOESNT WORK...
now i wrote below code:
DATA: L_S_INFOSTRU LIKE biw_kna1_s.
CASE I_DATASOURCE.
WHEN '0ustomer_attr'.
DATA: biw_kna1_s_data LIKE biw_kna1_s.
LOOP AT C_T_DATA INTO L_S_INFOSTRU.
L_TABIX = SY-TABIX.
biw_kna1_s_data-ZZXYZNO = KNKK-GRUPP
ENDLOOP.
ENDCASE.
but it is still not pulling in values from extractor...
can you please correct my code ???

Try something like
FIELD-SYMBOLS: <customer_attr> TYPE biw_kna1_s.
CASE i_datasource.
WHEN '0CUSTOMER_ATTR'. " Upper case
    LOOP AT c_t_data ASSIGNING <customer_attr>.
      SELECT grupp INTO <customer_attr>-zzxyzno
        FROM knkk UP TO 1 ROWS
        WHERE kunnr = <customer_attr>-kunnr.
      ENDSELECT. " not whole primary key
    ENDLOOP.
ENDCASE.
If performance problems arise ("SELECT in a LOOP"), first fill an internal table with a FOR ALL ENTRIES IN c_t_data in a sorted internal table (kunnr and grupp field, key kunnr) , then in the LOOP use a READ TABLE. (mandatory if you use such exits on big extractions.
Regards,
Raymond

Enhance CRM extractor for BW

Hi all,
To enhance CRM extractors we enhance the BDoc and then used the BADI CRM_BWA_MFLOW or CRM_BWA_SFLOW whichever is applicable to extract the data for the enhanced fields and fill the data source.
Also we go to transaction RSA6 enhance the datasource structure.
Now my basic question is why User exists are also enhanced. The procedure is
In transaction RSA6 select the datasource structure and choose the menu "Function enhancment". This goest to CMOD transaction and there the user exit "EXIT_SAPLRSAP_001" is enhanced
Could someone explain me why some coding is done in the user exit when the data which needs to be send from the BDoc is already filled in the badi implementation. When does this user exit actually used. In what scenarios do we use this user exit along with the badi implementation.
Any idea. Thanks for the continued support and I wish "Happy new year" to all of you.
Thanks in advance
Jothi

Hi all,
To enhance CRM extractors we enhance the BDoc and then used the BADI CRM_BWA_MFLOW or CRM_BWA_SFLOW whichever is applicable to extract the data for the enhanced fields and fill the data source.
Also we go to transaction RSA6 enhance the datasource structure.
Now my basic question is why User exists are also enhanced. The procedure is
In transaction RSA6 select the datasource structure and choose the menu "Function enhancment". This goest to CMOD transaction and there the user exit "EXIT_SAPLRSAP_001" is enhanced
Could someone explain me why some coding is done in the user exit when the data which needs to be send from the BDoc is already filled in the badi implementation. When does this user exit actually used. In what scenarios do we use this user exit along with the badi implementation.
Any idea. Thanks for the continued support and I wish "Happy new year" to all of you.
Thanks in advance
Jothi

Extractor enhacement problem - 0WBS_ELEMT_ATTR

Datasource 0WBS_ELEMT_ATTR
First 100 records from extraction test.
We enhanced the extractor (via RSU5_SAPI_BADI) to include the following fields:
Field Name     Field Type
ZZTERRIT01     Calculated Field
ZZTERRIT02     Calculated Field
ZZTERRIT03     Calculated Field
ZZTERRIT04     Calculated Field
ZZTERRIT05     Calculated Field
ZZTERRIT06     Calculated Field
ZZTERRIT7     Calculated Field
Z_C_EXEC     Table Field
Z_ECONOMIC     Table Field
Z_FUNCIONAL     Table Field
ZTERRITORIS     Table Field
Our BAdi implementation name is ZZRSU5_SAPI_BADI.
As you can see in the images below all fields are populated in test mode (transaction RSA6).
The problem arises when we execute the Datasource in BI.
Weu2019re not getting calculated fields populated in BI.
I have a detailed document explaining the enhancement we made, but can't attach it here.
Thanks!

Hi Oscar
Did you replicate the datasource....the fields appear there?
The fields appear. Datasource extraction in test mode brings all fields but the ZZT* came up empty.
Did you load to PSA in BI....are the fields there?...
Fields are in PSA.
Did you change the transfer rules in order to add the new fields in the structure??
Datasource as been migrated to new concept. No transfer rules apply.
I don't know what else to check

How to enhance Standard Extractor for 0CUSTOMER_ATTR

Hi,
I need to enhance the standard extractor of 0CUSTOMER_ATTR in order to populate the newly added attributes.
I have few questions:-
1) Will there be any impact of manually adding attributes to 0CUSTOMER on the data flow/where used list of 0CUSTOMER.
2) In order to get the master data for newly added attributes we will need to enhance the extractor. Could you let me know the entire process of enhancing the standard extractor.
3) Will it be safe to make a copy of 0CUSTOMER as ZCUSTOMER, add the new attributes in ZCUSTOMER and use ZCUSTOMER for our requirement. In this case also we will need to enhance the extractor.
Your inputs will be helpful.
Thanks,
Naveen Kr. Choudhary

1) Will there be any impact of manually adding attributes to 0CUSTOMER on the data flow/where used list of 0CUSTOMER.
No there will not be any impact for the where used list of 0CUSTOMER info object, there will be effect once the enhanced data source is replicated to BI side.
2) In order to get the master data for newly added attributes we will need to enhance the extractor. Could you let me know the entire process of enhancing the standard extractor.
SE11 --> create the Structure
Tcode: RSA6 -> Double click on the Data source --> Now in the DS:customer version screen you can see the extract structure name --> double click on it -->Next you will find an option of Append Structure button --> click on it -->
Add the necessary field's in the Append Structure with Component Type:. Before you exit, make sure that you activate the
structure by clicking on the activate button.
Next
-->You need to confirm that the Added filed has been added to the DataSource and that it will be available to BW. When you go back at the Postprocess Datasource and Hierarchy screen(RSA6), select the same DataSource again and press the Change DataSource button .
Check for the filed that you had appended, it will be appeared at the bottom of the extract structure.
Once this is done now the appended fileds are ready in DS, now we need to populate the data from the corresponding tables.
For this Select the Data source 0customer_attr --> click on Function enhancement --> enter the project name and next enter the Enhancement RSAP0002 This enhancement has four components that are specific to each of the four types of R/3
DataSources:
Transaction data EXIT_SAPLRSAP_001
Master data attributes EXIT_SAPLRSAP_002
Master data texts EXIT_SAPLRSAP_003
Master data hierarchies EXIT_SAPLRSAP_004
With these four components , any R/3 DataSource can be enhanced suing the above 4 Function module. In this case, you are enhancing a Master data DataSource, so you only need EXIT_SAPLRSAP_002 .
Next we need ABAP developer in order to enahance the DS and write the logic to populate the values to the filed from the source table.
once this is done save the code and activate it.
Next fill the set up tables and Goto RSA3 tcode check the data source and check for the fileds that were appened are populated with the values or not.
(for more detailed steps our friend Chowdary has send u the links go through them)
3) Will it be safe to make a copy of 0CUSTOMER as ZCUSTOMER, add the new attributes in ZCUSTOMER and use ZCUSTOMER for our requirement. In this case also we will need to enhance the extractor.
I dont think there is a need for creating a new ZCUSTOMER , you can use the standard one.
Edited by: prashanthk on Aug 13, 2010 9:02 AM

Enhancing HR Extractors

Hi Gurus,
I am getting into a HR project where we have to enhance some of the HR data sources (Benefits, PA, time and payroll). i want to know the procedure to enhance HR extractors. Is it the same as other datasources or do we have to do different when handling cluster tables?
normally we append fields to our extract structure and write code in cmod is it the same for HR datasources?
can someone give me guidence or necessary steps to be taken when enhancing HR datasources especially when handling fields from cluster tables?
would be great help
Pallavi

Hi,
It is same for HR too.First append structure adding new filed that you need then feed this with code in cmod.Please check the link below that is showing HR datasource enhancement.
How to enhance 0HR_PT_2 DataSource.
Regards.

Three new bioinformatic coding problems now in WIKI (all require regex)

At the bottom of this page:
https://wiki.sdn.sap.com/wiki/display/EmTech/Bio-InformaticBasicsInRelationtoScriptingLanguages
I've defined three new bioinformatic coding problems (Problems 3a-c).
These all involve regex parsing in one way or another and are therefore a lot more interesting than the first two problems I've presented.
I'm hoping that Anton will continue to knock out solutions, and that others will feel challenged enough to join him.
djh

Anton -
I am way impressed - not just by your code and how fast you produced it, but also by the speed with which you grasped the STRIDE documentation and put it to very good use.
Regarding the question you ask at the very end - this question goes to the heart of why protein tertiary structure (the actual 3-dimensional shape of one chain of a protein) is so hard to predict, and why governments, universities, and pharma are throwing so much money at it.
If protein primary and secondary structure were many-to-one, prediction of protein tertiary strructure would be a lot lot simpler. (For example, if "VVAY" and all "similar" primary structure subsequences mapped to the same secondary structure.)
But the mapping is, unfortunately, many-to-many because the amino acids (AAs) in a primary structure chain always bond the same way - the COOH (carboxy) of one AA bonds to the HN (amino) of the next one to produce C-N with the OH and H going away to make a water moleculre ... COOH - HN ---> C-N + H20.
And as pointed out by Linus Pauling (the discoverer of protein secondary structure), the C-N bond can take two forms:
a) one that is llkely to force the two amino acids to become HH (part of a helix)
b) one that is likely to force the two amino acids to become EE (part of a "stand")
You may be surprised to find out that even primary structure subsequences of six amino acids can wind up as different secondary structures - not always "H" vs "E", the variants might be
E TT H
H TT E
EEE HH
HH EEE
etc.
Anyway, thanks a lot for what you've done here.
If you decide to stay involved a little longer, you will very soon be able to understand why there may be real promise in the approach to protein structure that is being taken here:
http://strucclue.ornl.gov
(This is why I want to get SAP interested in the vertical bioinformatic sector - you can see why an integrated IDE with a robust DB is so important.)
BTW, the site mentions Dr. Arthur Lesk as a team member. Arthur is considered one of the fathers of what is called "structural alignment" (as opposed to pure sequence alignment.)
If you Google him, you'll see that he has written many many books on bioinformatics - all worth purchasing if you're going to become involved in this area. Arthur was at Cambridge (MRC) until recently, when he reached mandatory EU retirement age and took a position at Penn State here in the US.
Best
djh

Coding problem with my website

On my website, rockycapellaprods.com, I have a coding problem with the labeling of the videos as well as the videos playing on the website. Everything works great on the IWEB site, but as I loaded the information on the GoDaddy hosting site, several pages have a problem with the playing the videos and having several of the images moving onto the written areas. Do you have any solutions so the videos and the images stay on the website where I set them up?

this would be a problem with style sheets or CSS and common with iFrames. If you have a fixed width for the body on your page template, you will have varying results of layout when you view the page.
If you have your editor stretched to a certain width across your screen, you will likely be able to layout all your text blocks and objects into the places you want which may or may not ignore the "width" restrictions of the body. when you upload the site and open it in a browser, the layout could change because of the width restrictions in the HTML or CSS code and thus "wrap" to the next line.
THe solution is to be familiar with static and fixed positioning of text and objects within your page. Be familiar with text that wraps around images, or images placed within a text box, etc. How your images and text react in relation to each other is all part of the code for the objects, text, and body parameters combined.
I'm sorry there isnt a fast fix for this, and it would literally be an extended lesson posted here online to take you thru understanding the code, how it works, what its affects are, style sheets, template restrictions and so on. One thing you can do is stretch the browser window open more to see if your objects align themselves similar to what you saw in iWeb editor. if it does, your template is set to "percentage of page width" for the body of the page.
Message was edited by: iRocket
Message was edited by: iRocket

Coding Problem 6 Now Defined in Scripting Languages/Bioinformatics WIKI

In the "Scripting Languages and Bioinformatics" WIKI, I have completed a new page here:
https://wiki.sdn.sap.com/wiki/display/EmTech/Bio-InformaticBasicsPartII-AlignmentToolsforRelatingProteinGenestoProteinPrimaryStructures
and also defined Coding Problem 6 at the end of this page.
This problem involves scripting an interactive session with a web site and parsing what the web site returns at various points duing the session.
Am looking foward to a script that solves this problem, if anyone feels like spending the time to do it.

<?
// sequence to search ---------------------------------------------
$bquery      = "MTQIIKIDPLNPEIDKIKIAADVIRNGGTVAFPTETVYGLGANAFDG";
$bquery     .= "NACLKIFQAKNRPVDNPLIVHIADFNQLFEVAKDIPDKVLEIAQIVW";
$bquery     .= "PGPLTFVLKKTERVPKEVTAGLDTVAVRMPAHPIALQLIRESGVPIA";
$bquery     .= "APSANLATRPSPTKAEDVIVDLNGRVDVIIDGGHTFFGVESTIINVT";
$bquery     .= "VEPPVLLRPGPFTIEELKKLFGEIVIPEFAQGKKEAEIALAPGMKYK";
$bquery     .= "HYAPNTRLLLVENRNIFKDVVSLLSKKYKVALLIPKELSKEFEGLQQ";
$bquery     .= "IILGSDENLYEVARNLFDSFRELDKLNVDLGIMIGFPERGIGFAIMN";
$bquery     .= "RARKASGFSIIKAISDVYKYVNI";
// url for form1 --------------------------------------------------
$url = "http://blast.ncbi.nlm.nih.gov:80/Blast.cgi";
// parameters for form1 -------------------------------------------
$bdb         = "protein";
$bgeneticcode= "1";
$bquery_from = "";
$bquery_to   = "";
$bjobtitle   = "ACW-" . time();
$bdatabase   = "nr";
$bblastprog = "tblastn";
$bpagetype   = "BlastSearch";
$pf = "";
$pf .= "QUERY=" . $bquery;
$pf .= "&db=" . $bdb;
$pf .= "&QUERY_FROM=" . $bquery_from;
$pf .= "&QUERY_TO=" . $bquery_to;
$pf .= "&JOB_TITLE=" . $bjobtitle;
$pf .= "&DATABASE=" . $bdatabase;
$pf .= "&BLAST_PROGRAMS=" . $bblastprog;
$pf .= "&PAGE_TYPE=" . $bpagetype;
$pf .= "&GENETIC_CODE=1";
$pf .= "&DBTYPE=";
$pf .= "&EQ_MENU=";
$pf .= "&EQ_TEXT=";
$pf .= "&NEWWIN=";
$pf .= "&MATCH_SCORES=";
$pf .= "&MAX_NUM_SEQ=100";
$pf .= "&EXPECT=10";
$pf .= "&WORD_SIZE=3";
$pf .= "&MATRIX_NAME=BLOSUM62";
$pf .= "&GAPCOSTS=11 1";
$pf .= "&COMPOSITION_BASED_STATISTICS=2";
$pf .= "&REPEATS=";
$pf .= "&FILTER=";
$pf .= "&LCASE_MASK=";
$pf .= "&TEMPLATE_LENGTH=";
$pf .= "&TEMPLATE_TYPE=";
$pf .= "&I_THRESH=0.005";
$pf .= "&CLIENT=web";
$pf .= "&SERVICE=plain";
$pf .= "&CMD=request";
$pf .= "&PAGE=Translations";
$pf .= "&PROGRAM=tblastn";
$pf .= "&MEGABLAST=";
$pf .= "&RUN_PSIBLAST=";
$pf .= "&SELECTED_PROG_TYPE=tblastn";
$pf .= "&SAVED_SEARCH=true";
$pf .= "&BLAST_SPEC=";
$pf .= "&QUERY_BELIEVE_DEFLINE=";
$pf .= "&DB_DIR_PREFIX=";
$pf .= "&SHOW_OVERVIEW=true";
$pf .= "&SHOW_LINKOUT=true";
$pf .= "&GET_SEQUENCE=true";
$pf .= "&FORMAT_OBJECT=Alignment";
$pf .= "&FORMAT_TYPE=HTML";
$pf .= "&ALIGNMENT_VIEW=Pairwise";
$pf .= "&MASK_CHAR=2";
$pf .= "&MASK_COLOR=1";
$pf .= "&DESCRIPTIONS=100";
$pf .= "&ALIGNMENTS=100";
$pf .= "&NEW_VIEW=true";
$pf .= "&OLD_BLAST=true";
$pf .= "&NCBI_GI=false";
$pf .= "&SHOW_CDS_FEATURE=false";
$pf .= "&NUM_OVERVIEW=100";
$pf .= "&FORMAT_EQ_TEXT=";
$pf .= "&FORMAT_ORGANISM=";
$pf .= "&EXPECT_LOW=";
$pf .= "&EXPECT_HIGH=true";
$pf .= "&QUERY_INDEX=0";
// define the HTTP connection -----------------------------
$ch = curl_init();
curl_setopt($ch,CURLOPT_URL,$url);
curl_setopt($ch, CURLOPT_POST, 1);
curl_setopt($ch,CURLOPT_POSTFIELDS, $pf);
curl_setopt($ch,CURLOPT_COOKIEJAR,
dirname(__FILE__).'/cookie.txt');
curl_setopt($ch,CURLOPT_FOLLOWLOCATION,1);
curl_setopt($ch, CURLOPT_HEADER , 1);
curl_setopt($ch, CURLOPT_RETURNTRANSFER,1);
// call it ------------------------------------------------
$my_result = curl_exec($ch);
// get the request ID; the query takes some time and this ID
// allows to identify the original request
$query = "/<tr><td>Request ID<\/td><td> <b>([0-9A-Z]*)<\/b><\/td><\/tr>/";
preg_match($query, $my_result, $request_id);
// query for the result page every 2 seconds...when the result
// is ready, we recognize it by its signature
$not_ready = true;
$result_url = "http://blast.ncbi.nlm.nih.gov/Blast.cgi?CMD=Get&VIEW_RESULTS=FromRes&RID=" . $request_id[1];
while($not_ready){
$temp_page = null;
curl_setopt($ch,CURLOPT_URL,$result_url);
curl_setopt($ch, CURLOPT_POST, 0);
$my_result = curl_exec($ch);
$query = "/This page will be automatically updated in <b>(\d*)<\/b> seconds/";
preg_match($query, $my_result, $temp_page);
if(isset($temp_page[1])) { sleep(2); }
else { $not_ready = false; }
// parse the results page; split it into result fragments first --------
$pat = "/";
$pat .= "><input type=\"checkbox\" name=\"getSeqGi\"([^\n]*)\n";
$pat .= "Length=\d*\n\n";
$pat .= "[\w\s]*:\n";
$pat .= "(\s*<a[^>]*>[^<]*<\/a>\n)*\n";
$pat .= "([^\n]*\n){3}\n";
$pat .= "(([^\n]*\n){3}\n[^n])*";
$pat .= "/";
preg_match_all($pat, $my_result, $fragments);
// 'fine parse the result fragments and get some important parameters -----
foreach($fragments[0] as $fragment){
$query = "/<a href=\"http:\/\/(www\.ncbi\.nlm\.nih\.gov\/entrez\/query\.fcgi\?";
$query .= "[^>]*)>([^<]*)<\/a><a[^>]*>[^<]*<\/a>\s*<a[^>]*><img[^>]*><\/a>([^\n]*)/";
preg_match($query, $fragment, $u);
$query = "/\s*Score\s*=\s*(\d*) bits\s*$\d*$,\s*Expect\s*=\s*([^,]*),";
$query .= "[^\n]*\n\s*Identities\s*=\s*\d*\/\d*\s*$(\d*%)$[^\n]*\n\s*Frame\s*=\s*([^\n]*)\n/";
preg_match($query, $fragment, $u1);
preg_match_all("/Sbjct\s*(\d*)\s*[A-Z\-]*\s*(\d*)\n/", $fragment, $positions);
$fr["url"]        = $u[1];
$fr["shname"]     = $u[2];
$fr["name"]       = $u[3];
$fr["score"]      = $u1[1];
$fr["expect"]     = $u1[2];
$fr["identities"] = $u1[3];
$fr["frame"]      = $u1[4];
// find out if we have to reverse the strand direction or not; adjust
// lower and upper limit
if ($fr["frame"] >= 0) {
    $fr["high"] = $positions[2][count($positions)-1]; $fr["low"] = $positions[1][0]; $fr["reverse"] = ""; }
else {
    $fr["high"] = $positions[1][0]; $fr["low"] = $positions[2][count($positions)-1]; $fr["reverse"] = true;}
$frx[] = $fr;
// we call the final details form for the top ranked result
// here we could loop over several results
curl_setopt($ch,CURLOPT_URL,$frx[0]["url"]);
curl_setopt($ch, CURLOPT_POST, 0);
$my_result = curl_exec($ch);
// parse the final details form to get the necessary parameters to execute
// the final details form
preg_match("/<input name=\"WebEnv\" type=\"hidden\" value=\"([^\"]*)\"/",
           $my_result, $u5);
preg_match("/<input name=\"query_key\" type=\"hidden\" value=\"([^\"]*)\"/",
           $my_result, $u6);
preg_match("/<input name=\"db\" type=\"hidden\" value=\"([^\"]*)\"/",
           $my_result, $u7);
preg_match("/<input name=\"qty\" type=\"hidden\" value=\"([^\"]*)\"/",
           $my_result, $u8);
preg_match("/<input name=\"c_start\" type=\"hidden\" value=\"([^\"]*)\"/",
           $my_result, $u9);
preg_match(
"/<select name=\"dopt\".*<option value=\"([^\"]*)\" selected=\"1\">/",
$my_result, $u10);
preg_match(
"/<select name=\"dispmax\".*<option value=\"([^\"]*)\" selected=\"1\">/",
$my_result, $u11);
preg_match(
"/<select name=\"sendto\".*<option value=\"([^\"]*)\" selected=\"1\">/",
$my_result, $u12);
preg_match(
"/<input type=\"hidden\" id=\"([^\"]*)\" name=\"fmt_mask\".*value=\"([^\"]*)\"/",
$my_result, $u13);
preg_match(
"/<input type=\"checkbox\" id=\"truncate\" name=\"truncate\" value=\"([^\"]*)\"\/>/",
$my_result, $u14);
// fill in the necessary parameters parsed out now and earlier
$of = "WebEnv=" . $u5[1];
$of .= "&query_key=" . $u6[1];
$of .= "&db=" . $u7[1];
$of .= "&qty=" . $u8[1];
$of .= "&c_start=" . $u9[1];
$of .= "&dopt=" . $u10[1];
$of .= "&dispmax=" . $u11[1];
$of .= "&sendto=" . $u12[1];
$of .= "&fmt_mask=" . $u13[1];
$of .= "&truncate=" . $u14[1];
$of .= "&less_feat=";
$of .= "&from=" . $fr["low"];
$of .= "&to=" . $fr["high"];
$of .= "&strand=" . $fr["reverse"];
$of .= "&extrafeatpresent=1";
$of .= "&ef_SNP=1";
$of .= "&ef_CDD=8";
$of .= "&ef_MGC=16";
$of .= "&ef_HPRD=32";
$of .= "&ef_STS=64";
$of .= "&ef_tRNA=128";
$of .= "&ef_microRNA=256";
$of .= "&ef_Exon=512";
$of .= "&submit=Refresh";
$ourl = "http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?" . $of;
// execute the final details form
curl_setopt($ch,CURLOPT_URL,$ourl);
curl_setopt($ch, CURLOPT_POST, 0);
curl_setopt($ch,CURLOPT_POSTFIELDS, $of);
curl_setopt($ch,CURLOPT_FOLLOWLOCATION,1);
curl_setopt($ch, CURLOPT_HEADER , 1);
curl_setopt($ch, CURLOPT_RETURNTRANSFER,1);
$my_result = curl_exec($ch);
// parse the result page and get the final ORIGIN snippet
preg_match("/ORIGIN\s*\n\s*<a name=\"[^\"]*\"><\/a>\s*([^\/]*)\//", $my_result, $u99);
// output the final result ----------------------------------
echo "\n" . preg_replace("/\s{2,}/", "\n", preg_replace("/\d+\s/", "", $u99[1]));
?>
Edited by: Anton Wenzelhuemer on Aug 6, 2008 8:08 PM (Re-Formatted)

Problem enhancing 0CUSTOMER_ATTR extractor

Hi gurus!
I´ve tried to enhance the standard datasource 0CUSTOMER_ATTR , appending some custom fields to the extraction structure.
I followed the following procedure:
1. Go to RSA6.
2. Select the Data Source.
3. Select display Data Source (Ctr+F2).
4. Double click on the Extract structure.
5. Click on the Append Structure.
6. Add the required field .
7. Activate the Append Structure.
8. Go to CMOD.Give the Project, select Display.
9. Click on ZXRSAU01.
10.you have the bellow exits:
a).Transaction data: EXIT_SAPLRSAP_001
b).Master data attributes: EXIT_SAPLRSAP_002
c).Master data texts: EXIT_SAPLRSAP_003
d).Master data hierarchies: EXIT_SAPLRSAP_004
11. select Master data attributes: EXIT_SAPLRSAP_002,then you have to write the ABAP CODE
12. save and activate.
13. check the data in RSA3.
When i returned to the RSA6 transaction to unhide the fields they are not there!
I tried to test with the RSA3 and the enhanced field is being populated. Then i tried to replicate the Data source in the BW system, but the new field is not transferred to BW.
I also check with RSA2 and in the fields TABS, my custom included fields appear with the 'A' .
Please can someone help me with this bug??
Best Regards,
Telmo S.

Hello!
Thank you all for your answers but my problem is not yet solved.
Arminder Singh: I´ve followed that procedure. It´s not the first time i enhance a standard datasource and i´ve never had this problem.
Pankaj@bcone: When i try to generate the datasource an information message appear saying that there is a standard field with a DEC definition and that could lead to a short dump if the length of the field grows too much. This information message is blocking the datasource generation?
debajyoti08: I don´t even have the fields available to unmark the "Hide" option...
Is there some kind of a problem with the field "UMSAT" in this standard datasource??
Best Regards,
Telmo S.
Edited by: Telmo S. on Dec 16, 2009 11:52 AM

Enhancing CRM Extractors

Hello Gurus,
I have done some enhancement for 0CRM_SRV_PROCESS_I data source using user exit program by calling CRM_ORDER_READ function module.
With this we are experiencing some performance problem as CRM_ORDER_READ is bit slow.
That was my concern till today......
But today when I start debugging the DS, I came to know that standard extractor itself calls CRM_ORDER_READ FM to fill some standard fields. So, I thought of enhancing the DDS at WA by adding segments and it's fields and thought that we dont need to write code for this (I mean no user exit program, but need minimum code in MAP FM). But, even I assigned segments to fields, data is not populating. The reason I found here that these enhanced filed's are not included into standard DS's ..MAP_I function module.
Here my question is, do we have to generate any thing to include those fields into the FM? If Yes, from where? Or do we have to write user exit program to fill the fields?
Or any other ways can we solve this problem?
appreciate your help....
Thanks
RKR...

Hi RKR,
Yes if you're using the function crm_order_read, it take quite time,,, but it's very powerfull, since it will take a lot of information from there. You just use 1 function to get so many information about order.
I suggest you 2 ways :
1. Instead using that function, you can fetch the directly to the table according to your data's need. e.g. table crmd_orderadm_h, etc.
Or.
2. You make small program in BW to get data from CRM (using fm: crm_order_read), then you put the data to some table in BW.
Then, you create generic datasource whose type is <b>view -> get data from that table in BW </b> ( not a function module).
That small program can be scheduled periodically / you use process chain in order to run :
1. the small program
2. fetching those data from table using generic datasource whose type is view.
Hopefully it can helps you a lot ...
Best regards,
Niel.
(Many thanks for any points you choose to assign).

Classification extractor (CTBW) - problems with deleted classifications

Hello all,
we have several classification objects on 0customer. Until now we always made a FULL load for this classification extractors but now we realized the following problem:
If a customer has an classification and it is deleted we don't get the deletion into BI. In our master data the customer still has his old (invalid) classification.
I made some tests with the delta extraction. The only things we get by delta is changes on the classification value or if a classification is added. What don't get the case that the classification is deleted on a special customer.
How can we solve this problem? Any ideas?
This would be great!
Thanks a lot + kind regards from sunny Germany
Bettina

Hi Bettina,
well I think you need to do an enhancement for the datasource and add some code to check for deleted data. But I am not sure if there are change documents in cdhdr/cdpos for this type of data. If it is the case, you can get the deletions from there and append to your data package. Additionally you need to update a field in the data package with a 'D'. I believe you have a field for update mode in the data package. When the data is posted to a ods the record mode 'D' will cause the deletion of that record.
Siggi

ThinkPad Bluetooth with Enhanced Data Rate Software Problem

I'm having a weird issue. I use a X200t tablet with Windows 7 Profession 64-bit.
Apparently my current "ThinkPad Bluetooth with Enhanced Data Rate Software" is Version. 6.2.1.2900.
Thinkvantage System Update wants me to download and install Version 6.2.1.3100.
However, it tries and I get Error 1935 and it rolls back. Now when I start windows I get an alert about BTTray.exe not loading.
Of course I searched this problem, but it seems to be some ancient thing (years old) and I've never had a problem before with any of the Bluetooth updates.
I did notice that in past versions people said when they tried to uninstall the old version and install the new one, it just wiped their hard drive. I don't want to risk that so I thought I'd check here if anyone knew what was going on.
Thanks!

Hi
Welcome to Lenovo Community
You can directly download and install this package . It will not do any harm to any other component of Operating System
http://support.lenovo.com/en_US/detail.page?LegacyDocID=MIGR-70042
Hope This Helps
Cheers!!!

HELP!!! can't get my site uploaded to the host due to some coding problem.

have publish to folder from my iweb. intended to upload files to other hosting company. Downloaded Cyberduck to FTP file for the uploading. But have a problem as the hosting staff says that my files are loaded correctly but doesn't show probably due to some coding needs to be done to index.html. I've no idea how to do coding and the staff could not assist me either. Can someone help me please?

My thought was that this happens when you have some kind of naming conflict that interferes with the separate index.html page that iWeb creates on publishing.
You need to keep the name of your site short, so name your site something like Site or perhaps TT for short. Rather than naming any of your pages index, name them Home, Welcome or whatever fits with your site. Don't use underscores in a name. If you have a longer page name, then just enter it with the spaces and iWeb will do the rest for you on publication.
When you click on publish to a folder, iWeb will create one folder with your site name on it that contains all the folders and files for your site. It also creates a separate index.html file and you need to upload both of these via ftp.
With Cyberduck, link to your space and click on action at the top and upload. Upload the whole of your site folder (don't upload the pages separately, or they will be in the incorrect order and may not be seen) and then your index.html page and then place these items into the public_html folder or it could be named www and your website should then be live.

Enhance BW Extractor - coding problems

Similar Messages

Maybe you are looking for