Backslashes getting stripped out of my regex

I am trying to automate some find/replace routines in dreamweaver using javascript.
dreamweaver.setUpFindReplace({ 
        searchString: '<table width="\d+', 
        replaceString: '<table width="100%"', 
        searchWhat: "document", 
        searchSource: true, 
        useRegularExpressions: true 
    dreamweaver.replaceAll();
This query gets passed as: <table width="d+
Problem: when the query string is passed to the setUpFindReplace object, the backslashes get stripped out. Backslashes are key to regular expressions. How do I get them passed from JavaScript to Dreamweaver?
I am using CS6
Ben

I am still looking for a smart person to answer, but in case anyone else is having same problem I found a work-around.
I think Java uses the backslash as an escape character and so it is not passing it to Dreamweaver. The only thing I found that works is to set a variable with the regex text, and escaping all the backslashes, then passing the variable to Dreamweaver.
var myFind = '<table width="\\d+"'
dreamweaver.setUpFindReplace({
        searchString: myFind
        replaceString: '<table width="100%"',
        searchWhat: "document",
        searchSource: true,
        useRegularExpressions: true
    dreamweaver.replaceAll();
Note: double backslash \\d+ and single quotes ' " " ' used because query string contains double quotes.
I tried escaping the double quotes in the search string \" but this did not work for the same reason.
Ben (not a Java developer)

Similar Messages

  • Content-Length Header being stripped out of Gatewayed pages

    I am working to integrate the GPL'ed Moodle e-learning web application with Plumtree.  However, I'm hitting a snag.  For certain POST events, Moodle expects to receive a content-length header.
    When I use the application outside the portal, it works fine, and the Content-Length header is sent.  However, when I have the application gatewayed through the portal, the Content-Length header seems to get stripped out of the HTTP request and I get HTTP error 411 (Content Length Required).
    Is there a way I can convince the portal to not strip out the Content Length HTTP header?

    I'm working with .NET portal.
    For the particular file that caused the error as reported in the tcptrace log, I opened IIS manager, found the virtual directory, right clicked to open the properties dialog and checked directory security.
    Select edit anonymous access to check the account used for anonymous access, supply the user account needed and allow IIS to manage password. If in doubt check the settings on pages containing http post that are functioning properly.
    Check Integrated Widows Authentication
    I found this virutal directory had no user in the anonymous account, not sure how this happened. This resulted in pages that contained post/postbacks giving the "length required" error when I hit a button to perform the post/postback. Pages that did not contain Posts/Postback work correctly.

  • Exif data gets stripped exporting to camera roll

    I import pics from camera roll to edit in PST. I then export back to camera roll so tha I can use another picture management app to sort my edited pics into files. However the original exif data seems to get stripped out, especially the original date an time the original photo was taken. Apps like Photogene and Filterstorm do no do this. Is there a way of stopping this happening ? Or is it a bug ..... Why can the original exif data not be left intact ?

    Sounds daft as it would probably be easier for the app to eave the exif data intact rather than deliberately alter it !
    I hope adobe can put his right as preserving the original date and time of a photo is crucial for some photographers. This kinda prevents me from using PST as it is very important for me, and I no need to resort back to using Photogene.

  • InDesign links stripped out when relinking to new InCopy file

    I am working on a large manual in InDesign CS4.  Previously, there was an .incd file linked within the links panel.  When I open the .indd file, the box comes up to update the links.  We now have a new .icml file from InCopy that I relink to.  What is happening is all the links in the link panel as well as within the document are getting stripped out when I link to the new InCopy file.  The only file left is the .icml in the links panel.
    Has anyone had this happen to them?  If so, I would love to know how you fixed it.  Or if anyone has any suggestions I would really appreciate it.
    Thanks.
    Catnip

    Hi,Thanks for writing.
    I am relinking from an older story to a new one. When the editor upgraded to InCopy CS4 and told me he had completed his updates, within the folder were both the old .incd files as well as the new .icml.  I removed the old .incd then opened the InDesign file.  When I go to relink by right clicking on the old InCopy file, the new .icml file replaces everything within the links panel within InDesign as well as stripping all linked graphics from the pages.
    Catnip

  • Schema name stripped out in apex

    I can get the results in SQLPlus with following query (same user as apex)but if, for example, I try and run the query below within apex I get the following error
    select T_SEQ_ID, ALIGNMENT_LENGTH,
    Q_SEQ_START, Q_SEQ_END, Q_FRAME, T_SEQ_START,
    T_SEQ_END, T_FRAME, score, EXPECT as evalue
    from TABLE(BLASTP_ALIGN (
    'MHPKVDALLSRFPRITLIPWETPIQYLPRISRELGVDVYVKRDDLTGLGIGGNKIRKLEFLLGDALSRGCDTVIT
    IGAVH',
    CURSOR(SELECT seq_id, seq_data
    FROM swissprot),
    1,
    -1,
    0,
    0,
    'BLOSUM62',
    10,
    0,
    0,
    3,
    0,
    0)) t
    where t.score > 25;
    ORA-22303: type ""."DMBGOS" not found
    I checked that DMBGOS is a valid type within the DMSYS schema. It seems the schema name gets stripping out in apex for some reason. Can someone take a close look at it?
    Thanks,
    Ke Lin

    Hello,
    How did you grant privileges on BLASTP_ALIGN etc to the user? Was it via a role perhaps? (That won't work in APEX, it needs to be a direct grant).
    John
    Blog: http://jes.blogs.shellprompt.net
    Work: http://www.apex-evangelists.com
    Author of Pro Application Express: http://tinyurl.com/3gu7cd
    REWARDS: Please remember to mark helpful or correct posts on the forum, not just for my answers but for everyone!

  • Character entity getting stripped by Dreamweaver

    I'm using some Supplementary Private Use Area-A character entities to load some custom font icons, &#xF0000;, &#xF0001;, and &#xF0002;. For some reason, Dreamweaver keeps stripping out the &#xF0000; entity when I save the document. The other two entities do not get stripped out. I only use the code editor, not the WSYIWYG and my character encoding is set to UTF-8: <meta content="text/html; charset=utf-8" http-equiv="Content-Type">. Am I doing something wrong or is there a setting I'm missing?

    I can confirm this also happens in CS6 ver 12.2 #6006.  I don't know why that particular entity code won't stick.  You can file a bug report below:
    https://www.adobe.com/cfusion/mmform/index.cfm?name=wishform
    Nancy O.

  • I just upgraded to the latest software for my pages.  When I opened an old document it stripped out all the images I had in my tables.  How do I get them back

    I just upgraded to the latest software for my pages.  When I opened an old document it stripped out all the images I had in my tables.  How do I get them back

    Don't save. Close the documents.
    Pages '09 should still be in your Applications/iWork folder.
    Pages 5 will damage/alter older files, something Apple didn't tell its users.
    Pages 5 is a severely stripped down version with over 90+ features removed.
    We recommend trashing/archiving Pages 5 after Exporting any files you may have saved back to Pages '09.
    Also rate/review Pages 5 in the App store.
    Peter

  • How to strip out leading numbers in auto-generated bookmarks?

    For years now my team has used an Acrobat plug-in called Compose, which lets us strip out the leading numbers from bookmarks in PDFs generated from FrameMaker 7.2. (The tool works after the fact, so that all bookmark creation occurs after the PDF is created.)
    For example, these document headings:
    1.1 Intro to Happy Fun Ball
    1.1.1. System Requirements
    1.1.2. Cautionary Information (WARNING)
    are translated to the bookmarks:
    Intro to Happy Fun Ball
    System Requirements
    Cautionary Information (WARNING)
    After evaluating the new Adobe Tech Comm Suite, it seems that Acrobat 9 Extended Pro isn't compatible with the Compose plug-in (or at least, the version we've been using for years).
    Does anyone know if there's a method -- built into either FrameMaker 8 or Acrobat 9 Pro Extended, or in an SDK -- that allows you to auto-generate bookmarks but strip out leading numbers? It seems this is a no-brainer of a feature, yet I can't find it listed anywhere in the Acrobat documentation.
    Other names for this feature might be "wild card" or "text masking," not to mention "strip leading numbers."
    Thanks very much for your help.
    Regards,
    Buster

    The following code can be run from the JavaScript console, but since you're new to this, it might be easier to create a button, paste the code shown below into the Mouse Up event of the button, select the Hand tool and click the button to execute the code, and then delete the button if everything is OK.
    If you need to do this a lot, you should consider setting up a custom menu item or toolbar button that executes this code:
    function removeBookmarkPrefix(bookmark) {
        // Resursive function to remove bookmark prefix
        // Rename bookmark without prefix
        bookmark.name = bookmark.name.replace(/^\S+\s+/, "");
        if (bookmark.children != null) {
            for (var i = 0; i < bookmark.children.length; i++) {
                removeBookmarkPrefix(bookmark.children[i]);
    // Remove all bookmark prefixes, recursively
    removeBookmarkPrefix(bookmarkRoot);
    The code uses what's called a regular expression, which in this case is fairly simple: /^\S+\s+/
    This regular expression means to search the bookmark name for the beginning of the string (^), followed by one or more non-whitespace characters (\S+), followed by one or more white space characters (\s+), and replace all that with an empty string (""), thus removing it. This should work with the bookmark name prefixes you describe.
    The function is called recursively, which is an efficient way to handle the hierarchical structure that the bookmark tree can have.
    If you get stuck, post again.
    George

  • Incoming MIDI data from unassociated devices still gets sent out in 2.1.3

    The problem I have reported numerous times for previous versions of MainStage is still present in 2.1.3.
    An incoming MIDI CC value that is NOT associated with a device is being sent to other channel strips. Last night before rehearsal, I added a Minimoog XL into my rig. It's connected via its own MIDI port on a MOTU 128 Express. I discovered that when I turned the Vol control on the Minimoog, it sent out CC 7 and CC 39 (LSB values for volume) messages to a channel strip associated with a VocalLive voice processor and had absolutely NOTHING to do with the Minimoog.
    As reported before, this also happens for CC80 and CC81 and I cannot see any reason why such events would get sent out to other channel strips if there is no explicit mapping defined. 
    I had to add in new dummy knobs to explicitly block these values, further polluting my layout, which is already full of knobs defined just for blocking stuff.
    A generic MIDI device set to listen on all inputs and MIDI channels with output blocked does NOT stop this from happening.
    More details are in these older threads:
    https://discussions.apple.com/message/12572359#12572359 and with more detail (including how to reproduce) at
    https://discussions.apple.com/message/15483068#15483068 is still present in 2.1.3
    (I've already submitted this at the feedback link (which, by the way, has no entry for 2.1.3 in it) but I am quite pessimistic about this getting fixed, it has survived many versions of MainStage....I don't understand why)
    This is so disappointing.

    That's partially why I'm so concerned about this --- I cannot conceive of a scenario where this behavior makes any sense --- essentially some external synth can generate arbitrary MIDI data which just goes out through other channels, and that data is at best of no interest and at worst can actually screw up the receiving device (which happened to me when my Korg Oasys was sending out CC80/CC81 as part of a program change and it was changing a parameter on my Minimoog)
    It seems to me that they could have fixed this quite easily by providing (perhaps an extended version of) a MIDI Device that REALLY blocks everything so users with the problem could just throw that one gadget into the layout instead of having to make a bunch of knobs to block all sorts of things.

  • In Photoshop CS6, Save for Web strips out my filename after a period "." character

    I have a file named label-1.5oz.psd.  In Photoshop CS6 when I use "Save for Web" to save it as a JPG, it only wants to save a part of the filename: label-1.jpg
    I strips out everything after the period "." character.  I know it's incorrectly thinking that's a file extension.
    Any ideas how I can fix this?  Any settings I should tweak?  I'd really love for it to save the full filename without requiring me to retype the last part every time.
    Thanks in advance for any help!

    Oh if only it were that easy...  Unfortunately, they have to be cropped and resized, converting over from a print catalog where much of that work was originally done in InDesign, and now have to convert each individual image to make the web site look like the catalog...  but thanks for the suggestion, have already tried to automate what I could..  But much of this is going to be hands on...  getting my familiar quick keys to function correctly would help greatly.

  • PSE 7 Strips Out Slide Show Music

    I have created a PSE 7 slide show of about 150 pictures.  I have included a music track as background while the slides play.  I full screen preview the slide show and all is good -- I can also save and go out of PSE 7 then go back in and open the slide show and re-preview and all is still good.  I then select to output the slide show to DVD and let PSE and Premier run their standard course to get to a burned DVD.  All is good, no errors, and the process completes ending in a burned DVD.
    Problem is that near the beginning of the process, when PSE 7 creates the .wmv file, it strips out the music track for the slide show.  I know this is where the problem occurs because I have gone in and played the .wmv file in Windows Media Player and the slides are fine but no music.
    I have done the exact same thing with only 6 slides and music is in fact included.  The burned DVD of that small slide show plays fine and with music.
    What is going on???  Does making a slide show with 150 pictures push the limits of what PSE 7 can handle, even though I get no error messages???
    Thanks!

    PSE slide show has some issues with high resolution images. Please reduce the size of the image 1000 x 700 and create/burn DVD.

  • Double extension stripped out in Internet Explorer?

    Hi all,
    I was just browsing through some Oracle 9i jsp related demo pages, when I came across this situation:
    a sample code page with a double extension, exampletag.tld.txt, that should just display the source code, results instead in a internet explorer parsing error :
    "The XML page cannot be displayed, bla bla bla".
    Another page with extension .jsp.txt gets executed as if ".txt" wasn't there at all.
    It looks like Internet Explorer is stripping out the rightmost extension and is trying to interpret the page.
    I guess this could potentially lead to some security risk, if you can run some code out of a plain text document!
    I checked this out with IE 5.5SP2 and IE6.0 SP1 and they behave the same.
    On the contrary Mozilla 1.5 correctly outputs the page as plain text.
    Also, I've checked the mime type configuration in Apache and it's apparently serving text/plain as expected.
    As I've recently installed MSXML3 SP4 on both machines, I am wondering if this fact is correlated in some way.
    Bye,
    Flavio

    Must be my promote-Mozilla-Firebird-week :-)
    When installing the Live HTTP Headers extension in Mozilla Firebird you can easily see what the real content type is that the server sends to the browser. Regardless of any extension, the server can tell the browser to interpret any URL just the way the server likes -- like even a URL with a JPG extension could be handled as HTML by the browser, just if the server tells it to. And a URL that ends in .cflav could easily yield an image in the morning and an XML document in the evening. So: there actually is no such thing as extension when it comes to URLs.
    And to make things more complicated: the browser starts a request by telling the server what it can handle, and as such the server might decide to serve different content (or content types) to different browsers.
    I've checked the mime type configuration in Apache ...well, Apache is not serving the JSP files, is it? Might very well be that Apache passes handling of certain virtual folders to the JSP engine, which then can decide to parse .txt files as well.
    So: check out Firebird to get a jump start in your investigation!
    Arjan.

  • I am getting logged out of ALL of my accounts

    I am getting logged out of ALL of my accounts using my computer
    - Gmail
    - crailgsilst
    - yahoo mail
    - yandex
    I have to loginto google cometimes 10 times in 2 minutes.
    Its a newer retina MBP. HOW DO I STOP THIS?

    1. This procedure is a diagnostic test. It changes nothing, for better or worse, and therefore will not, in itself, solve the problem. But with the aid of the test results, the solution may take a few minutes, instead of hours or days.
    Don't be put off by the complexity of these instructions. The process is much less complicated than the description. You do harder tasks with the computer all the time.
    2. If you don't already have a current backup, back up all data before doing anything else. The backup is necessary on general principle, not because of anything in the test procedure. Backup is always a must, and when you're having any kind of trouble with the computer, you may be at higher than usual risk of losing data, whether you follow these instructions or not.
    There are ways to back up a computer that isn't fully functional. Ask if you need guidance.
    3. Below are instructions to run a UNIX shell script, a type of program. As I wrote above, it changes nothing. It doesn't send or receive any data on the network. All it does is to generate a human-readable report on the state of the computer. That report goes nowhere unless you choose to share it. If you prefer, you can act on it yourself without disclosing the contents to me or anyone else.
    You should be wondering whether you can believe me, and whether it's safe to run a program at the behest of a stranger. In general, no, it's not safe and I don't encourage it.
    In this case, however, there are a couple of ways for you to decide whether the program is safe without having to trust me. First, you can read it. Unlike an application that you download and click to run, it's transparent, so anyone with the necessary skill can verify what it does.
    You may not be able to understand the script yourself. But variations of the script have been posted on this website thousands of times over a period of years. The site is hosted by Apple, which does not allow it to be used to distribute harmful software. Any one of the millions of registered users could have read the script and raised the alarm if it was harmful. Then I would not be here now and you would not be reading this message.
    Nevertheless, if you can't satisfy yourself that these instructions are safe, don't follow them. Ask for other options.
    4. Here's a summary of what you need to do, if you choose to proceed:
    ☞ Copy a line of text in this window to the Clipboard.
    ☞ Paste into the window of another application.
    ☞ Wait for the test to run. It usually takes a few minutes.
    ☞ Paste the results, which will have been copied automatically, back into a reply on this page.
    The sequence is: copy, paste, wait, paste again. You don't need to copy a second time. Details follow.
    5. You may have started the computer in "safe" mode. Preferably, these steps should be taken in “normal” mode, under the conditions in which the problem is reproduced. If the system is now in safe mode and works well enough in normal mode to run the test, restart as usual. If you can only test in safe mode, do that.
    6. If you have more than one user, and the one affected by the problem is not an administrator, then please run the test twice: once while logged in as the affected user, and once as an administrator. The results may be different. The user that is created automatically on a new computer when you start it for the first time is an administrator. If you can't log in as an administrator, test as the affected user. Most personal Macs have only one user, and in that case this section doesn’t apply. Don't log in as root.
    7. The script is a single long line, all of which must be selected. You can accomplish this easily by triple-clicking anywhere in the line. The whole line will highlight, though you may not see all of it in the browser window, and you can then copy it. If you try to select the line by dragging across the part you can see, you won't get all of it.
    Triple-click anywhere in the line of text below on this page to select it:
    PATH=/usr/bin:/bin:/usr/sbin:/sbin:/usr/libexec;clear;cd;p=(Software Hardware Memory Diagnostics Power FireWire Thunderbolt USB Fonts SerialATA 4 1000 25 5120 KiB/s 1024 85 \\b%% 20480 1 MB/s 25000 ports ' com.clark.\* \*dropbox \*genieo\* \*GoogleDr\* \*k.AutoCAD\* \*k.Maya\* vidinst\* ' DYLD_INSERT_LIBRARIES\ DYLD_LIBRARY_PATH -86 "` route -n get default|awk '/e:/{print $2}' `" 25 N\\/A down up 102400 25600 recvfrom sendto CFBundleIdentifier 25 25 25 1000 MB com.apple.AirPortBaseStationAgent 464843899 51 5120 files );N5=${#p[@]};p[N5]=` networksetup -listnetworkserviceorder|awk ' NR>1 { sub(/^\([0-9]+\) /,"");n=$0;getline;} $NF=="'${p[26]}')" { sub(/.$/,"",$NF);print n;exit;} ' `;f=('\n%s: %s\n' '\n%s\n\n%s\n' '\nRAM details\n%s\n' %s\ %s '%s\n-\t%s\n' );S0() { echo ' { q=$NF+0;$NF="";u=$(NF-1);$(NF-1)="";gsub(/^ +| +$/,"");if(q>='${p[$1]}') printf("%s (UID %s) is using %s '${p[$2]}'",$0,u,q);} ';};s=(' /^ *$|CSConfigDot/d;s/^ */   /;s/[-0-9A-Fa-f]{22,}/UUID/g;s/(ochat)\.[^.]+(\..+)/\1\2/;/Shared/!s/\/Users\/[^/]+/~/g ' ' s/^ +//;/de: S|[nst]:/p;' ' {sub(/^ +/,"")};/er:/;/y:/&&$2<'${p[10]} ' 1s/://;3,6d;/[my].+:/d;s/^ {4}//;H;${ g;s/\n$//;/s: [^EO]|x([^08]|02[^F]|8[^0])/p;} ' ' 5h;6{ H;g;/P/!p;} ' ' ($1~/^Cy/&&$3>'${p[11]}')||($1~/^Cond/&&$2!~/^N/) ' ' /:$/{ N;/:.+:/d;s/ *://;b0'$'\n'' };/^ *(V.+ [0N]|Man).+ /{ s/ 0x.... //;s/[()]//g;s/(.+: )(.+)/ (\2)/;H;};$b0'$'\n'' d;:0'$'\n'' x;s/\n\n//;/Apple[ ,]|Genesy|Intel|SMSC/d;s/\n.*//;/\)$/p;' ' s/^.*C/C/;H;${ g;/No th|pms/!p;} ' '/= [^GO]/p' '{$1=""};1' ' /Of/!{ s/^.+is |\.//g;p;} ' ' $0&&!/ / { n++;print;} END { if(n<200) print "com.apple.";} ' ' $3~/[0-9]:[0-9]{2}$/ { gsub(/:[0-9:a-f]{14}/,"");} { print|"tail -n'${p[12]}'";} ' ' NR==2&&$4<='${p[13]}' { print $4;} ' ' END { $2/=256;if($2>='${p[15]}') print int($2) } ' ' NR!=13{next};{sub(/[+-]$/,"",$NF)};'"`S0 21 22`" 'NR!=2{next}'"`S0 37 17`" ' NR!=5||$8!~/[RW]/{next};{ $(NF-1)=$1;$NF=int($NF/10000000);for(i=1;i<=3;i++){$i="";$(NF-1-i)="";};};'"`S0 19 20`" 's:^:/:p' '/\.kext\/(Contents\/)?Info\.plist$/p' 's/^.{52}(.+) <.+/\1/p' ' /Launch[AD].+\.plist$/ { n++;print;} END { print "'${p[41]}'";if(n<200) print "/System/";} ' '/\.xpc\/(Contents\/)?Info\.plist$/p' ' NR>1&&!/0x|\.[0-9]+$|com\.apple\.launchctl\.(Aqua|Background|System)$|'${p[41]}'/ { print $3;} ' ' /\.(framew|lproj)|\):/d;/plist:|:.+(Mach|scrip)/s/:[^:]+//p ' '/^root$/p' ' !/\/Contents\/.+\/Contents|Applic|Autom|Frameworks/&&/Lib.+\/Info.plist$/ { n++;print;} END { if(n<1100) print "/System/";} ' '/^\/usr\/lib\/.+dylib$/p' ' /Temp|emac/{next};/(etc|Preferences|Launch[AD].+)\// { sub(".(/private)?","");n++;print;} END { print "'${p[41]}'.plist\t'${p[42]}'";if(n<500) print "Launch";} ' ' /\/(Contents\/.+\/Contents|Frameworks)\/|\.wdgt\/.+\.([bw]|plu)/d;p;' 's/\/(Contents\/)?Info.plist$//;p' ' { gsub("^| |\n","\\|\\|kMDItem'${p[35]}'=");sub("^...."," ") };1 ' p '{print $3"\t"$1}' 's/\'$'\t''.+//p' 's/1/On/p' '/Prox.+: [^0]/p' '$2>'${p[43]}'{$2=$2-1;print}' ' BEGIN { i="'${p[26]}'";M1='${p[16]}';M2='${p[18]}';M3='${p[31]}';M4='${p[32]}';} !/^A/{next};/%/ { getline;if($5<M1) a="user "$2"%, system "$4"%";} /disk0/&&$4>M2 { b=$3" ops/s, "$4" blocks/s";} $2==i { if(c) { d=$3+$4+$5+$6;next;};if($4>M3||$6>M4) c=int($4/1024)" in, "int($6/1024)" out";} END { if(a) print "CPU: "a;if(b) print "I/O: "b;if(c) print "Net: "c" (KiB/s)";if(d) print "Net errors: "d" packets/s";} ' ' /r\[0\] /&&$NF!~/^1(0|72\.(1[6-9]|2[0-9]|3[0-1])|92\.168)\./ { print $NF;exit;} ' ' !/^T/ { printf "(static)";exit;} ' '/apsd|BKAg|OpenD/!s/:.+//p' ' (/k:/&&$3!~/(255\.){3}0/ )||(/v6:/&&$2!~/A/ ) ' ' $1~"lR"&&$2<='${p[25]}';$1~"li"&&$3!~"wpa2";' ' BEGIN { FS=":";p="uniq -c|sed -E '"'s/ +\\([0-9]+\\)\\(.+\\)/\\\2 x\\\1/;s/x1$//'"'";} { n=split($3,a,".");sub(/_2[01].+/,"",$3);print $2" "$3" "a[n]$1|p;b=b$1;} END { close(p);if(b) print("\n\t* Code injection");} ' ' NR!=4{next} {$NF/=10240} '"`S0 27 14`" ' END { if($3~/[0-9]/)print$3;} ' ' BEGIN { L='${p[36]}';} !/^[[:space:]]*(#.*)?$/ { l++;if(l<=L) f=f"\n   "$0;} END { F=FILENAME;if(!F) exit;if(!f) f="\n   [N/A]";"file -b "F|getline T;if(T!~/^(AS.+ (En.+ )?text$|(Bo|PO).+ sh.+ text ex)/) F=F" ("T")";printf("\nContents of %s\n%s\n",F,f);if(l>L) printf("\n   ...and %s more line(s)\n",l-L);} ' ' s/^ ?n...://p;s/^ ?p...:/-'$'\t''/p;' 's/0/Off/p' ' END{print NR} ' ' /id: N|te: Y/{i++} END{print i} ' ' / / { print "'"${p[28]}"'";exit;};1;' '/ en/!s/\.//p' ' NR!=13{next};{sub(/[+-M]$/,"",$NF)};'"`S0 39 40`" ' $10~/\(L/&&$9!~"localhost" { sub(/.+:/,"",$9);print $1": "$9;} ' '/^ +r/s/.+"(.+)".+/\1/p' 's/(.+\.wdgt)\/(Contents\/)?Info\.plist$/\1/p' 's/^.+\/(.+)\.wdgt$/\1/p' ' /l: /{ /DVD/d;s/.+: //;b0'$'\n'' };/s: /{ /V/d;s/^ */- /;H;};$b0'$'\n'' d;:0'$'\n'' x;/APPLE [^:]+$/d;p;' ' /^find: /d;p;' "`S0 44 45`" ' BEGIN{FS="= "} /Path/{print $2} ' );c1=(system_profiler pmset\ -g nvram fdesetup find syslog df vm_stat sar ps sudo\ crontab sudo\ iotop top pkgutil 'PlistBuddy 2>&1 -c "Print' whoami cksum kextstat launchctl sudo\ launchctl crontab 'sudo defaults read' stat lsbom mdfind ' for i in ${p[24]};do ${c1[18]} ${c2[27]} $i;done;' defaults\ read scutil sudo\ dtrace sudo\ profiles sed\ -En awk /S*/*/P*/*/*/C*/*/airport networksetup mdutil sudo\ lsof test osascript\ -e );c2=(com.apple.loginwindow\ LoginHook '" /L*/P*/loginw*' "'tell app \"System Events\" to get properties of login items'|tr , \\\n" 'L*/Ca*/com.ap*.Saf*/E*/* -d 1 -name In*t -exec '"${c1[14]}"' :CFBundleDisplayName" {} \;|sort|uniq' '~ $TMPDIR.. \( -flags +sappnd,schg,uappnd,uchg -o ! -user $UID -o ! -perm -600 \)' '.??* -path .Trash -prune -o -type d -name *.app -print -prune' :${p[35]}\" :Label\" '{/,}L*/{Con,Pref}* -type f ! -size 0 -name *.plist -exec plutil -s {} \;' "-f'%N: %l' Desktop L*/Keyc*" therm sysload boot-args status " -F '\$Time \$Message' -k Sender kernel -k Message Req 'bad |Beac|caug|dead[^bl]|FAIL|fail|GPU |hfs: Ru|inval|jnl:|last value [1-9]|n Cause: -|NVDA\(|pagin|proc: t|Roamed|rror|ssert|Thrott|tim(ed? ?|ing )o|WARN' -k Message Rne 'Goog|ksadm|SMC:| VALI|xpma' -o -k Sender fseventsd -k Message Req 'SL' " '-du -n DEV -n EDEV 1 10' 'acrx -o comm,ruid,%cpu' '-t1 10 1' '-f -pfc /var/db/r*/com.apple.*.{BS,Bas,Es,J,OSXU,Rem,up}*.bom' '{/,}L*/Lo*/Diag* -type f -regex .\*[cgh] ! -name *ag \( -exec grep -lq "^Thread c" {} \; -exec printf \* \; -o -true \) -execdir stat -f:%Sc:%N -t%F {} \;|sort -t: -k2 |tail -n'${p[38]} '-L {/{S*/,},}L*/Lau* -type f' '-L /{S*/,}L*/StartupItems -type f -exec file {} +' '-L /S*/L*/{C*/Sec*A,E}* {/,}L*/{A*d,Ca*/*/Ex,Co{mpon,reM},Ex,Inter,iTu*/*P,Keyb,Mail/B,Pr*P,Qu*T,Scripti,Sec,Servi,Spo,Widg}* -path \\*s/Resources -prune -o -type f -name Info.plist' '/usr/lib -type f -name *.dylib' `awk "${s[31]}"<<<${p[23]}` "/e*/{auto,{cron,fs}tab,hosts,{[lp],sy}*.conf,pam.d/*,ssh{,d}_config,*.local} {,/usr/local}/etc/periodic/*/* /L*/P*{,/*}/com.a*.{Bo,sec*.ap}*t /S*/L*/Lau*/*t .launchd.conf" list getenv /Library/Preferences/com.apple.alf\ globalstate --proxy '-n get default' -I --dns -getdnsservers\ "${p[N5]}" -getinfo\ "${p[N5]}" -P -m\ / '' -n1 '-R -l1 -n1 -o prt -stats command,uid,prt' '--regexp --only-files --files com.apple.pkg.*|sort|uniq' -kl -l -s\ / '-R -l1 -n1 -o mem -stats command,uid,mem' '+c0 -i4TCP:0-1023' com.apple.dashboard\ layer-gadgets '-d /L*/Mana*/$USER&&echo On' '-app Safari WebKitDNSPrefetchingEnabled' "+c0 -l|awk '{print(\$1,\$3)}'|sort|uniq -c|sort -n|tail -1|awk '{print(\$2,\$3,\$1)}'" '/S*/*/Ca*/*xpc* >&- ||echo No' );N1=${#c2[@]};for j in {0..9};do c2[N1+j]=SP${p[j]}DataType;done;N2=${#c2[@]};for j in 0 1;do c2[N2+j]="-n ' syscall::'${p[33+j]}':return { @out[execname,uid]=sum(arg0) } tick-10sec { trunc(@out,1);exit(0);} '";done;l=(Restricted\ files Hidden\ apps 'Elapsed time (s)' POST Battery Safari\ extensions Bad\ plists 'High file counts' User Heat System\ load boot\ args FileVault Diagnostic\ reports Log 'Free space (MiB)' 'Swap (MiB)' Activity 'CPU per process' Login\ hook 'I/O per process' Mach\ ports kexts Daemons Agents launchd Startup\ items Admin\ access Root\ access Bundles dylibs Apps Font\ issues Inserted\ dylibs Firewall Proxies DNS TCP/IP Wi-Fi Profiles Root\ crontab User\ crontab 'Global login items' 'User login items' Spotlight Memory Listeners Widgets Parental\ Controls Prefetching SATA Descriptors XPC\ cache );N3=${#l[@]};for i in 0 1 2;do l[N3+i]=${p[5+i]};done;N4=${#l[@]};for j in 0 1;do l[N4+j]="Current ${p[29+j]}stream data";done;A0() { id -G|grep -qw 80;v[1]=$?;((v[1]==0))&&sudo true;v[2]=$?;v[3]=`date +%s`;clear >&-;date '+Start time: %T %D%n';};for i in 0 1;do eval ' A'$((1+i))'() { v=` eval "${c1[$1]} ${c2[$2]}"|'${c1[30+i]}' "${s[$3]}" `;[[ "$v" ]];};A'$((3+i))'() { v=` while read i;do [[ "$i" ]]&&eval "${c1[$1]} ${c2[$2]}" \"$i\"|'${c1[30+i]}' "${s[$3]}";done<<<"${v[$4]}" `;[[ "$v" ]];};A'$((5+i))'() { v=` while read i;do '${c1[30+i]}' "${s[$1]}" "$i";done<<<"${v[$2]}" `;[[ "$v" ]];};';done;A7(){ v=$((`date +%s`-v[3]));};B2(){ v[$1]="$v";};for i in 0 1;do eval ' B'$i'() { v=;((v['$((i+1))']==0))||{ v=No;false;};};B'$((3+i))'() { v[$2]=`'${c1[30+i]}' "${s[$3]}"<<<"${v[$1]}"`;} ';done;B5(){ v[$1]="${v[$1]}"$'\n'"${v[$2]}";};B6() { v=` paste -d: <(printf "${v[$1]}") <(printf "${v[$2]}")|awk -F: ' {printf("'"${f[$3]}"'",$1,$2)} ' `;};B7(){ v=`grep -Fv "${v[$1]}"<<<"$v"`;};C0(){ [[ "$v" ]]&&echo "$v";};C1() { [[ "$v" ]]&&printf "${f[$1]}" "${l[$2]}" "$v";};C2() { v=`echo $v`;[[ "$v" != 0 ]]&&C1 0 $1;};C3() { v=`sed -E "$s"<<<"$v"`&&C1 1 $1;};for i in 1 2;do for j in 0 2 3;do eval D$i$j'(){ A'$i' $1 $2 $3; C'$j' $4;};';done;done;{ A0;D20 0 $((N1+1)) 2;D10 0 $N1 1;B0;C2 27;B0&&! B1&&C2 28;D12 15 37 25 8;A1 0 $((N1+2)) 3;C0;D13 0 $((N1+3)) 4 3;D23 0 $((N1+4)) 5 4;D13 0 $((N1+9)) 59 50;for i in 0 1 2;do D13 0 $((N1+5+i)) 6 $((N3+i));done;D13 1 10 7 9;D13 1 11 8 10;D22 2 12 9 11;D12 3 13 10 12;D23 4 19 44 13;D23 5 14 12 14;D22 6 36 13 15;D22 7 37 14 16;D23 8 15 38 17;D22 9 16 16 18;B1&&{ D22 35 49 61 51;D22 11 17 17 20;for i in 0 1;do D22 28 $((N2+i)) 45 $((N4+i));done;};D22 12 44 54 45;D22 12 39 15 21;A1 13 40 18;B2 4;B3 4 0 19;A3 14 6 32 0;B4 0 5 11;A1 17 41 20;B7 5;C3 22;B4 4 6 21;A3 14 7 32 6;B4 0 7 11;B3 4 0 22;A3 14 6 32 0;B4 0 8 11;B5 7 8;B1&&{ A2 19 26 23;B7 7;C3 23;};A2 18 26 23;B7 7;C3 24;A2 4 20 21;B7 6;B2 9;A4 14 7 52 9;B2 10;B6 9 10 4;C3 25;D13 4 21 24 26;B4 4 12 26;B3 4 13 27;A1 4 22 29;B7 12;B2 14;A4 14 6 52 14;B2 15;B6 14 15 4;B3 0 0 30;C3 29;A1 4 23 27;B7 13;C3 30;D13 24 24 32 31;D13 25 37 32 33;A2 23 18 28;B2 16;A2 16 25 33;B7 16;B3 0 0 34;B2 21;A6 47 21&&C0;B1&&{ D13 21 0 32 19;D13 10 42 32 40;D22 29 35 46 39;};D23 14 1 62 42;D12 34 43 53 44;D12 22 50 32 52;D22 0 $((N1+8)) 51 32;D13 4 8 41 6;D12 26 28 35 34;D13 27 29 36 35;A2 27 32 39&&{ B2 19;A2 33 33 40;B2 20;B6 19 20 3;};C2 36;D23 33 34 42 37;B1&&D23 35 45 55 46;D23 32 31 43 38;D12 36 47 32 48;D13 20 42 32 41;D13 37 2 48 43;D13 4 5 32 1;D13 4 3 60 5;D12 26 48 49 49;B3 4 22 57;A1 26 46 56;B7 22;B3 0 0 58;C3 47;D22 4 4 50 0;D23 22 9 37 7;A7;C2 2;} 2>/dev/null|pbcopy;exit 2>&-
    Copy the selected text to the Clipboard by pressing the key combination command-C.
    8. Launch the built-in Terminal application in any of the following ways:
    ☞ Enter the first few letters of its name into a Spotlight search. Select it in the results (it should be at the top.)
    ☞ In the Finder, select Go ▹ Utilities from the menu bar, or press the key combination shift-command-U. The application is in the folder that opens.
    ☞ Open LaunchPad. Click Utilities, then Terminal in the icon grid.
    Click anywhere in the Terminal window and paste by pressing command-V. The text you pasted should vanish immediately. If it doesn't, press the return key.
    9. If you see an error message in the Terminal window such as "Syntax error" or "Event not found," enter
    exec bash
    and press return. Then paste the script again.
    10. If you're logged in as an administrator, you'll be prompted for your login password. Nothing will be displayed when you type it. You will not see the usual dots in place of typed characters. Make sure caps lock is off. Type carefully and then press return. You may get a one-time warning to be careful. If you make three failed attempts to enter the password, the test will run anyway, but it will produce less information. In most cases, the difference is not important. If you don't know the password, or if you prefer not to enter it, press the key combination control-C or just press return  three times at the password prompt. Again, the script will still run.
    If you're not logged in as an administrator, you won't be prompted for a password. The test will still run. It just won't do anything that requires administrator privileges.
    11. The test may take a few minutes to run, depending on how many files you have and the speed of the computer. A computer that's abnormally slow may take longer to run the test. While it's running, there will be nothing in the Terminal window and no indication of progress. Wait for the line
    [Process completed]
    to appear. If you don't see it within half an hour or so, the test probably won't complete in a reasonable time. In that case, close the Terminal window and report what happened. No harm will be done.
    12. When the test is complete, quit Terminal. The results will have been copied to the Clipboard automatically. They are not shown in the Terminal window. Please don't copy anything from there. All you have to do is start a reply to this comment and then paste by pressing command-V again.
    At the top of the results, there will be a line that begins with the words "Start time." If you don't see that, but instead see a mass of gibberish, you didn't wait for the "Process completed" message to appear in the Terminal window. Please wait for it and try again.
    If any private information, such as your name or email address, appears in the results, anonymize it before posting. Usually that won't be necessary.
    13. When you post the results, you might see an error message on the web page: "You have included content in your post that is not permitted," or "You are not authorized to post." That's a bug in the forum software. Please post the test results on Pastebin, then post a link here to the page you created.
    14. This is a public forum, and others may give you advice based on the results of the test. They speak only for themselves, and I don't necessarily agree with them.
    Copyright © 2014 by Linc Davis. As the sole author of this work, I reserve all rights to it except as provided in the Use Agreement for the Apple Support Communities website ("ASC"). Readers of ASC may copy it for their own personal use. Neither the whole nor any part may be redistributed.

  • Stripping out data from unstructured documents

    I have hundreds of word and html documents that I need to strip out certain information. The html docs are completely unstructured. The word documents may or may not have the same structure. How can I leverage PL/SQL to extract out the data that I need? I have seen scripts where using PL/SQL you can give a byte position number. This may work for extracting out some of the data if positioned in the same place but I am looking to simplify the process and get the right information out in one pass. Any help would be greatly appreciated. I am not necessarily looking for an exact answer but rather information that can lead me in the right direction. Of course the exact answer wouldn't hurt.

    I read all of the thread for that particular post and I still don't believe I have what I need.
    Maybe it is the instr function that you wanted me to look at and maybe not. I just don't know how I would use that to extract data.
    What I am looking to do is to use some kind of PL/SQL statement to extract a unique identifier that will be in the document, dates that the document was created or appended, and then some region numbers. So can I use instr to find a value from each document, hold it in a flat file and then import this information back into the database? The value of course will be different in every document.
    These files are currently not in a database. I am trying to get this information out of the document to store as metadata for each document. Am I looking at the right way to do this using PL/SQL or is there some other method of data extraction that I should consider

  • How do I strip out all HTML tags except for safe ones I designate?

      // FLAG ALL INCIDENTS OF LEGITIMATE TAGS BY CONVERTING <..> TO <!..!>
      for (int i = 0; i < parseVector.size(); i++) {
       this.content =
        this.content.replaceAll("<(/?)(" + (String)parseVector.elementAt(i) + "[\\s\\t=]+[^>]*)>",
                       "\\<!$1$2!\\>");
      }I have a Vector of HTML string text consisting of things like:
    {"i", "b", "u", "blockquote", "font"}
    And within this.content, which contains HTML, I want to strip out all HTML except for certain "safe" tags.
    Problem is, my code fails to do just that.. while <img..> is gone, so is <i> and I want to keep the latter.
    I feel the problem is in my regular expression pattern within this.content.replaceAll() method, but maybe I'm wrong. What do you say?
    Entire code can be found in http://www.myjavaserver.com/~ppowell/HTMLParser.java
    Thanx
    Phil

    Let me give you an example of what I want:
    I understand what you want... I don't see how the code that you posted is supposed to that.
    The best advice I can give is that a for loop is not part of the equation here. You will need to do it in one regex I think. Because if what you are doing there is saying replace all the tags that aren't <i> on one loop and replace all the tags that are not <b> in another loop guess what is happening?
    On the first pass you don't replace the <i> tags but you do replace the <b> tags. On the next pass you replace <i> tags because they don't match the <b> etc.
    You see?
    So I think you need to do this all in one regex where the starting portion of the tag is NOT one of the set that you want to keep.

Maybe you are looking for

  • Can't delete line due to hyperlink error

    I am trying to delete a line in my document however the program does not let me and instead says "The object you have chosen is already in use by another hyperlink". But the line doesn't have a hyperlink on it! I need this line deleted but for the li

  • Changing to manuel syncing

    The directions say to click the ipod symbol in the left pane, etc. to change to manuel syncing after connecting your ipod. Doesn't syncing start right away and won't stuff start getting erased from my ipod if I've cleaned up my itunes and folders? Th

  • Non-Interactive Report Break Formatting

    I have a non-interactive report that is very large and I am trying to use break formatting to provide subtotals. It works, but is quite ugly. Can anyone tell me where I might find a list of the various substitution strings that can be used for contro

  • Port issue with j2ee engine, http service provider

    hi gurus, on two of our standalone j2ee servers, the j2ee engine is up and running fine. from the mmc everything shows green including messager server. but when i connect to the j2ee page using browser either from the client machine or  on the server

  • I connected my ipod before installing softwear and now it wont work

    i connected my ipod before installing softwear and now it wont work...like abosolutely nothing...its frozen