Schema name stripped out in apex

I can get the results in SQLPlus with following query (same user as apex)but if, for example, I try and run the query below within apex I get the following error
select T_SEQ_ID, ALIGNMENT_LENGTH,
Q_SEQ_START, Q_SEQ_END, Q_FRAME, T_SEQ_START,
T_SEQ_END, T_FRAME, score, EXPECT as evalue
from TABLE(BLASTP_ALIGN (
'MHPKVDALLSRFPRITLIPWETPIQYLPRISRELGVDVYVKRDDLTGLGIGGNKIRKLEFLLGDALSRGCDTVIT
IGAVH',
CURSOR(SELECT seq_id, seq_data
FROM swissprot),
1,
-1,
0,
0,
'BLOSUM62',
10,
0,
0,
3,
0,
0)) t
where t.score > 25;
ORA-22303: type ""."DMBGOS" not found
I checked that DMBGOS is a valid type within the DMSYS schema. It seems the schema name gets stripping out in apex for some reason. Can someone take a close look at it?
Thanks,
Ke Lin

Hello,
How did you grant privileges on BLASTP_ALIGN etc to the user? Was it via a role perhaps? (That won't work in APEX, it needs to be a direct grant).
John
Blog: http://jes.blogs.shellprompt.net
Work: http://www.apex-evangelists.com
Author of Pro Application Express: http://tinyurl.com/3gu7cd
REWARDS: Please remember to mark helpful or correct posts on the forum, not just for my answers but for everyone!

Similar Messages

How to parameterize the schema name in APEX

Hi,
How to parameterize the schema name in APEX , in order to access different tables from the respective schema.
For example:-
select NAME display_value, CODE return_value
from paramSchema.DESC_LIST WHERE SELECTION_FLG = 'Y'
order by 1
in the above code, paramSchema will be replaced with the actual schema name duing runtime. I tried doing so by some hidden fields on page, but it didn't worked out.
I took the schema name from the respective server as per the IPof the server.
stored in a hidden field named as schema.
And replaced the same in place of schema name. But no luck.
select NAME display_value, CODE return_value
from :schema.DESC_LIST WHERE SELECTION_FLG = 'Y'
order by 1
Please help me in shorting it out.
Thanks,
Anuradha

Hi
In order to do that, you would need to use dynamic SQL by changing the report type to PL/SQL Function Body Returning SQL Query and have code along the lines of
DECLARE
l_sql VARCHAR2(32767);
BEGIN
l_sql := 'select NAME display_value, CODE return_value
from '||:schema||'.DESC_LIST WHERE SELECTION_FLG = 'Y'
order by 1';
RETURN l_sql;
END;However, by doing this, you lose alot of flexibility. The other options would be...
To have seperate report regions that are conditional on the value of the variable.
To use a WITH clause at the tope of the query like...
WITH src_data AS
(SELECT * FROM schema1.my_table
WHERE :schema = 'schema1'
UNION ALL
SELECT * FROM schema2.my_table
WHERE :schema = 'schema2')
SELECT *
FROM src_dataOther than that you could look at using synonyms and doing something similar.
Hope this helps.
Cheers
Ben

OWB 10.1 Deploy Mgr. - Registration - schema name is grayed out, sometimes

Environment:
Repository - OWB 10.1.0.2 on UNIX (AIX 5.2)
Target - Oracle 9.2.0.4 on UNIX (AIX 5.2)
Question: I have several locations that have been registered in the past. When I right click a location and click on 'Register' in some cases the schema name comes up grayed out and I am unable to change it and other times it is open.
Why is that and how do I change the schema name of a location?
I have installed the new schema as a target through the runtime assistant and there is a working runtime repository in that instance.
Any help is greatly appreciated.
P.S. Yes, we are making plans to upgrade to 10.2 soon but not soon enough ;-)>
-gary

Hi,
In order to edit/delete a location you need to unregister the location from all the Control Centers. A location might be registered to more than one Control Centers.
Having said that if you have registered location A to Schema B in Control Center C, you need to unregister the location A from Control Center C.
In case you have accidentally dropped the Schema B without unregistering the location A, then even if you unregister the location A from Control Center C, you will still see the user name and password fields grayed out. In that case you need to re-create the schema B, register the location A and then again unregister the location and then you will be able to edit it. Seems to be a bug in OWB.
Regards
-AP

How to strip out leading numbers in auto-generated bookmarks?

For years now my team has used an Acrobat plug-in called Compose, which lets us strip out the leading numbers from bookmarks in PDFs generated from FrameMaker 7.2. (The tool works after the fact, so that all bookmark creation occurs after the PDF is created.)
For example, these document headings:
1.1 Intro to Happy Fun Ball
1.1.1. System Requirements
1.1.2. Cautionary Information (WARNING)
are translated to the bookmarks:
Intro to Happy Fun Ball
System Requirements
Cautionary Information (WARNING)
After evaluating the new Adobe Tech Comm Suite, it seems that Acrobat 9 Extended Pro isn't compatible with the Compose plug-in (or at least, the version we've been using for years).
Does anyone know if there's a method -- built into either FrameMaker 8 or Acrobat 9 Pro Extended, or in an SDK -- that allows you to auto-generate bookmarks but strip out leading numbers? It seems this is a no-brainer of a feature, yet I can't find it listed anywhere in the Acrobat documentation.
Other names for this feature might be "wild card" or "text masking," not to mention "strip leading numbers."
Thanks very much for your help.
Regards,
Buster

The following code can be run from the JavaScript console, but since you're new to this, it might be easier to create a button, paste the code shown below into the Mouse Up event of the button, select the Hand tool and click the button to execute the code, and then delete the button if everything is OK.
If you need to do this a lot, you should consider setting up a custom menu item or toolbar button that executes this code:
function removeBookmarkPrefix(bookmark) {
 // Resursive function to remove bookmark prefix
 // Rename bookmark without prefix
 bookmark.name = bookmark.name.replace(/^\S+\s+/, "");
 if (bookmark.children != null) {
 for (var i = 0; i < bookmark.children.length; i++) {
 removeBookmarkPrefix(bookmark.children[i]);
// Remove all bookmark prefixes, recursively
removeBookmarkPrefix(bookmarkRoot);
The code uses what's called a regular expression, which in this case is fairly simple: /^\S+\s+/
This regular expression means to search the bookmark name for the beginning of the string (^), followed by one or more non-whitespace characters (\S+), followed by one or more white space characters (\s+), and replace all that with an empty string (""), thus removing it. This should work with the bookmark name prefixes you describe.
The function is called recursively, which is an efficient way to handle the hierarchical structure that the bookmark tree can have.
If you get stuck, post again.
George

How does one strip out all Live Cycle data from a PDF and rebuild the form fields in Acrobat?

Someone in a different department built a bunch of forms in Live Cycle. We now need to make minor edits to these forms but we all have Macs and can't use Live Cycle. Currently our only option to change a date and a name on each form is to buy a new Windows workstation, buy a copy of Live Cycle and train someone for it.
I understand the Live Cycle technology and Acrobat technology for forms are somehow different but there must be a way to just strip out all the Live Cycle form programming so that I just have the bare PDF with the text and layout. Then make the text edits and rebuild the form fields in Acrobat.

It depends on your PDF. Is the PDF a static XFA or a dynamic XFA?
You can check to see if the PDF is static/dynamic by clicking File=>Save As, and it should say static or dynamic PDF as file type.
iText will work with Static XFA forms created in LiveCycle. Dynamic XFA forms are not supported.
You can also submit XML data to a server side script and parse the XML data using C# system.xml.xmlreader.
Another tool that may speed the development of the project is:
http://www.fdftoolkit.net/
Note: FDFToolkit.net utilizes iText Technologies.

What is table schema name?

Hi,
I was looking at DatabaseMetaData::getColumns() while searching for a way to get a table's column names and I run into these ugly params catalog and schemaPattern. Of course nowhere on the sun's site could I find a definition of these terms although they're used quite often in the API documentation. So I turned to a specific DBMS provider and found out that catalog is a fancy term for the system metadata. But what about the String schema param? I usually see a table's schema referred to as the "structure" of the table, what columns it contains of which types. But I've never known this "schema" can have a string name. Anyone so kind to explain it to me or better point me to a text that has definitions and explanations of the concepts used in the JDBC API documentation? And more generally for JDK where do you folks usually go when you want a simple explanation of how things work, not the dry listing of function and parameter names? Look at MSDN for example, it is both a good reference and a reasonable self-contained tutorial. Not that I praise Microsoft but...
BTW I found that probably ResultSetMetaData is more suitable for my initial purposes, but still the questions bother me. So if you have any suggestion please let me know.
Thank you in advance

To answer your question, what is a table schema name?, it is the name of the schema that the table belongs to. If you have an Oracle database, MYDB, it will have at the very least two users which are SYS and SYSTEM, these are schema names, there are objects that exists in their schema. If you create a new user, JAKE, and then create a bunch of objects as JAKE, these objects are said to belong to the JAKE schema. All objects are like this, not just tables (indexes, sequence tables, triggers, etc.).

DBACOCKPIT - wrong schema name

Hi,
We moved one of our satellite systems on another server. After that, the remote database monitoring in Solution Manager (7.0 EHP1 SPS26) doesn't work anymore. When I try to add the corresponding entry, the system refuses (database error 229 at EXE - Execute permission was denied on the object 'sap_tf_version') and I notice that the schema name is wrong (<domain>\SAPService<Solution Manager SID> instead of dbo). I can't replace the schema name because it is greyed out in the system information part.
So my question: where the system gains its information about schema name from ?
How to solve this problem ?
Kind regards,
Christophe

Hello Christophe,
Rerun the Database Monitoring setup at
http://<solman_host>:<solman_port>/smd
Navigate to Managed Systems -> Database Monitoring
Best regards,
Guilherme Balbinot

How to call a schema name using substitution name?

Hi All,
How to call a schema name using substitution menthod in odi?
I was trying but I got the following error..
ODI-1227: Task XXX(Procedure) fails on the source ORACLE connection YYY.
Caused By: java.sql.SQLException: Missing IN or OUT parameter at index:: 1
Here xxx procedurename.
yyy-schemaname
Please do the needful..
Thanking you in Advance.
Regards,
PP

1 declare
2 sql_string varchar2(2000);
3 begin
4 sql_string := 'select ' || func_name || ' into a from dual ';
5 execute immediate sql_string;
6* end;
SQL> /
sql_string := 'select ' || func_name || ' into a from dual ';
ERROR at line 4:
ORA-06550: line 4, column 28:
PLS-00201: identifier 'FUNC_NAME' must be declared
ORA-06550: line 4, column 1:
PL/SQL: Statement ignored
1 declare
2 sql_string varchar2(2000);
3 func_name varchar2(30);
4 begin
5 func_name := 'some_func';
6 sql_string := 'select ' || func_name || ' into a from dual ';
7 execute immediate sql_string;
8* end;
SQL> /
declare
ERROR at line 1:
ORA-00904: "SOME_FUNC": invalid identifier
ORA-06512: at line 7
SQL> desc some_func;
ERROR:
ORA-04043: object some_func does not exist
1 create or replace function test_func
2       return number
3       is
4       begin
5          return 0;
6*      end;
SQL> /
Function created.
1 declare
2 sql_string varchar2(2000);
3 func_name varchar2(30);
4 begin
5 func_name := 'test_func';
6 sql_string := 'select ' || func_name || ' into a from dual ';
7 execute immediate sql_string;
8* end;
SQL> /
declare
ERROR at line 1:
ORA-00905: missing keyword
ORA-06512: at line 7
SQL> Set serveroutput on
1   declare
2   sql_string varchar2(2000);
3   func_name varchar2(30);
4   return_value number;
5   begin
6   func_name := 'test_func';
7   sql_string := 'select ' || func_name || ' from dual ';
8   execute immediate sql_string into return_value;
9   dbms_output.put_line(return_value);
10* end;
SQL> /
0
PL/SQL procedure successfully completed.Hope that helps.
Regards
Raj

How to know database name and schema name

Hi ,
Once after logging in the database,how is it possible to know the current database and schema which we r using?Is there any system table where we can get the database names and schema names?
please help me out.itz urgent.
Regards,
Sravan

Probably not.
If the database name is the name of the current database, it would be essentially redundant. If the database name is the name of some other database, in order to get the names of all the tables in the specified schema, you could create a database link to the remote system (which assumes you have a login and password to the remote database with appropriate privileges, that the database server's tnsnames.ora file has an entry for the remote database, etc) and query the remote data dictionary tables. Even if you could do that, however, you could not dynamically create triggers on the remote database since DDL over a database link.
In theory, you could also load an appropriate JDBC driver into the database and write a Java stored procedure that would connect to the remote database (again, with an appropriate user name & password, host name, and port number) and issue DDL against that remote database. I have a hard time believing, however, that this would be a particularly beneficial approach. It would be easier just to put the appropriate code into each database that needs triggers generated or to have a separate Java application that generates triggers for a number of different databases.
Justin

What is the schema name for service part planning module

Hi Experts,
i need the following info
1. what is the schema name for SPP module
say for example we call ASCP as MSC, in similar passion what is the name given to SPP.
2. I have searched for the table details in etrm site ( in R12.1.1 ) but it is not available, can anyone help me out to get the table details in SPP ?
Thanks for your valuable time.
Bye
Babu

Thanks Bob for your clarification.
Do you have any idea, which are all the table that got linked with SPP in the MSC schema ?
If we have any separate link in metalink, pls share that link.
Thanks again for your valuable time.
Babu Ji

Schema name is not showing in the Data load

Hi All,
I am trying to load a CSV file using oracle apex data load option. The options are using a new table and file upload(.csv). In the load data page, the schema name is not listing my current schema because of which i could not to upload the CSV file.
Can anyone please help on this ?
I am using oracle apex 4.1.1
Regards
Rajendrakumar.P

Raj,
Did you export this application from another workspace perhaps? I have seen in the past that if you create a data load page based on schema A and then import that application and set it to parse as schema B, it will not work.
The solution - although unsupported - is to simply alter the parse-as schema reference in the APEX export file. A more supported version would be to re-create the data load pages in the target application, so that it picks up on the proper parse-as schema.
Thanks,
- Scott -
http://spendolini.blogspot.com
http://www.enkitec.com

DatabaseProcedure with return type prefixed with schema name

Hi (Paco)
I have a question about the DatabaseProcedure class. We are using Oracle proxy users for our database connections.
Everything is accessed via a database role that are granted to the logged on user. All our database objects, tables etc are protected with this database role.
When I want to call a database function/procedure I need to add the schema name as a prefix to the custom database object that we uses for parameters/return types.
So far so good. I can also define a parameter prefixed with schema name via the DatabaseProcedure.registerArrayType ...
But when I try to define a function call that uses this parameter I get an error saying "Declaration is not valid".
The problem is located to the PROCEDURE_DEFINITION regular pattern:
private static final Pattern PROCEDURE_DEFINITION = Pattern.compile("\\s* (FUNCTION|PROCEDURE) \\s+ ([\\w.$]+) \\s* (?:\$(.*?)\$)? \\s* (?:RETURN\\s+(\\w+))? \\s* ;? \\s*", CASE_INSENSITIVE | COMMENTS | DOTALL); The return type cannot be prefixed with the schema name.
Any good suggestions or workarounds?!
I actually did change the pattern runtime via reflection to make it work - but I really don't like this solution in the long run!
/Torben
Edited by: Zonic on 2013-05-07 10:52

Hi Torben,
I think I have a workaround for the issue that might work for you. If you look at the source of DatabaseProcedure.registerArrayType you find that it actually calls DatabaseProcedure.registerCustomParamType.
public static void registerArrayType(String name)
registerCustomParamType(name, Types.ARRAY, Array.getORADataFactory(), name);
}As a workaround you could replace your calls to DatabaseProcedure.registerArrayType with calls to DatabaseProcedure.registerCustomParamType as follows.
// Instead of DatabaseProcedure.registerArrayType("NAME.WITH.DOTS") call:
DatabaseProcedure.registerCustomParamType("anyNameWithoutDots", Types.ARRAY, Array.getORADataFactory(), "NAME.WITH.DOTS"); // Don't forget to use uppercase here.
DatabaseProcedure dp = DatabaseProcedure.define("procedure my.procedure(param1 in out anyNameWithoutDots)");
DatabaseProcedure.ParamType type = dp.getParamDef(0).getType();
System.out.println(type.getName() + " is " + type.getTypeName()); // ANYNAMEWITHOUTDOTS is NAME.WITH.DOTSThis way you don't have to use the "illegal" name in the DatabaseProcedure definition.
Regards,
Paco van der Linden

Missing schema names in sqlj generated for packages

We are using jpub, version 8.1.6.0.0 Production to generate code for ~100 packages and objects.
We are creating a connection other than the schema owner, and have prefixed all the lines in our input file with the schema name and a period. We AREN'T using the "omit_schema_names" option
The generated .sqlj code for objects includes a line like:
public static final String SQLNAME = "GHMINT.WD$DISPATCHER_CHNG_TRIP_OBJ";
where "GHMINT" is the schema we want.
HOWEVER, the generated .sqlj code for package methods includes code like:
#sql [_ctx] __jPt_result = { VALUES(WD$SECURITY.USER_LOGIN(
with no schema indication, and we would get errors complaining about undeclared identifiers.
We have a workaround that involves a sed script that inserts the schema info in the appropriate places, but this seems like a bug in jpub.
Comments, RTFMs, or pointers to a newer version would be appreciated.
Thanks,
null

Thank you for pointing out this oversight. It will be fixed promptly.
A. Thiesen, JPublisher development

Static Files with same name. How does apex determine which files to serve?

Hello, I'm using apex 4.2.1.00.08 and I cannot figure out how apex manages the static files and cannot find any help in the docs (other that some high level UI description).
The application is serving some file and I cannot find which one it is in any easy way.
I have a workspace where there are several files that have the same name, and I cannot understand how apex figures out which one to serve, and also don't understand what is value of associating a file with an application.
There are files associated with application 0, which don't appear to show up in the "shared components", but can be seen as
SELECT *
FROM wwv_flow_files
WHERE flow_id = 0;
and can apparently only be deleted using "SQL Commands" inside apex.
the URL called is something like
wwv_flow_file_mgr.get_file?p_security_group_id=13498126233076320&p_fname=myfile.css
so apparently the only parameters that matter are the workspace and the file name. The associated application is irrelevant.
apparently files linked to flow_id 0 have precedence over all the other files ...
Thanks for clearing up a bit of "fog" on this issue.

VC wrote:
Go to that application > shared components > Static files you should see the file.the problem is that there are multiple files with that name, and that sometimes the file being served is linked to application "0" and it doesn't show in the "shared components" interface ...
I have a workspace where there are several files that have the same name, and I cannot understand how apex figures out which one to serve, and also don't understand what is value of associating a file with an application.Static files can be uploaded to apex with optionally associating with an application within that workspace.
Files associated with an application are referenced using *#APP_IMAGES#*
Files not associated with an application are referenced using *#WORKSPACE_IMAGES#*I referenced with #WORKSPACE_IMAGES#, but now I see that if I use #APP_IMAGES# the URL generated will also contain the application ID. This would help to discriminate between different files with the same name but linked to different applications ...
There are files associated with application 0, which don't appear to show up in the "shared components", but can be seen asWhy are you particularly interested in application 0?Because somehow APEX puts the files that I uploaded there ... they can be seen selecting from wwv_flow_files. Do they take precedence over all other files with the same name?
Filename is unique for the given workspace[and application]I disagree. I have multiple files with the same name ... the root of this problem ...
so apparently the only parameters that matter are the workspace and the file name. The associated application is irrelevant.How is your static file referenced??
But not always, try associating an static file with and application and reference it using #APP_IMAGES# instead of #WORKSPACE_IMAGES#
See
http://docs.oracle.com/cd/E37097_01/doc/doc.42/e35125/concept_sub.htm#BEIDCGAJ
http://docs.oracle.com/cd/E37097_01/doc/doc.42/e35125/ui_file_manage.htm#HTMDB06011
Thanks, but the documentation doesn't give much details ... apparently files referenced with #WORKSPACE_IMAGES# can still resolve to files linked to specific applications ... I would like to understand the actual workflow for the various cases (file references with APP_IMAGES, referenced with WORKSPACE_IMAGES, file associated with the application, with another application, with no application, with application "0" ...).
Also, I find it somewhat misleading that you can have files associate with applications that don't exist anymore (e.g. have been deleted).
Edited by: GChierico on Apr 11, 2013 2:16 PM

Schema name and object name quoted together in MRU after v3 to v4 upgrade

After upgrading from v3 to v4 an app has a system generated Multi Row Update function that is broken;
PL/SQL : ORA-00972: identified is too long
declare
function x return varchar2
is
begin
    begin
      for c1 in ( select "MY_SCHEMA.MY_SEQUENCE".nextval pk from dual ) loop
       return c1.pk;
      end loop;
    end;
    return null;
end;
begin
dbms_output.put_line(x);
end;Note the Schema Name and the Object Name have been quoted together!
Is this a known issue and do you know of a fix?
Many thanks in advance
Craig

Hi Craig,
this problem is not known so far.
I had a look at the code and that change has been made because of multi byte support for sequence names and because of security reasons.
We try to avoid breaking changes in applications, but it looks like we haven't expected that developers are specifying sequence names prefixed by the schema name.
Maybe the following workaround is feasible for you:
1) Find all tabular form columns which are using a sequence with a schema prefix as primary key source
select *
from apex_application_page_rpt_cols
where primary_key_column_source_type = 'S'
   and instr(primary_key_column_source, '.') > 0;2) Go to that tabular form column and remove the schema prefix
3) If the sequence is really in a different schema than the parsing schema of your application, create a synonym for it.
Hope that solves your problem.
Regards
Patrick
My Blog: http://www.inside-oracle-apex.com
APEX Plug-Ins: http://apex.oracle.com/plugins
Twitter: http://www.twitter.com/patrickwolf

Schema name stripped out in apex

Similar Messages

Maybe you are looking for