OWB 10.1 Deploy Mgr. - Registration - schema name is grayed out, sometimes

Environment:
Repository - OWB 10.1.0.2 on UNIX (AIX 5.2)
Target - Oracle 9.2.0.4 on UNIX (AIX 5.2)
Question: I have several locations that have been registered in the past. When I right click a location and click on 'Register' in some cases the schema name comes up grayed out and I am unable to change it and other times it is open.
Why is that and how do I change the schema name of a location?
I have installed the new schema as a target through the runtime assistant and there is a working runtime repository in that instance.
Any help is greatly appreciated.
P.S. Yes, we are making plans to upgrade to 10.2 soon but not soon enough ;-)>
-gary

Hi,
In order to edit/delete a location you need to unregister the location from all the Control Centers. A location might be registered to more than one Control Centers.
Having said that if you have registered location A to Schema B in Control Center C, you need to unregister the location A from Control Center C.
In case you have accidentally dropped the Schema B without unregistering the location A, then even if you unregister the location A from Control Center C, you will still see the user name and password fields grayed out. In that case you need to re-create the schema B, register the location A and then again unregister the location and then you will be able to edit it. Seems to be a bug in OWB.
Regards
-AP

Similar Messages

Apple "Name" button grayed out

When I first installed Aperture 3, I started identifying people using the Name button.
Been away for a few weeks and thought I'd continue, but the"Name" button is grayed out and so is the "Faces" button and any other option that would allow me to assign names to faces and have Aperture take over.
This must be something I have done wrong, but what?

Possibly disabled "Faces" at "Aperture→Preferences→General"?

HT3805 why is the face and names feature grayed out in my aperture program?

why is my faces aand names feature in aperture 3.2 grayed out?

Are they greyed out in the toolbar or in the preferences? If the former, then enable them in preferences ;-)

Aperture name icon grayed out, why?

Why is my name icon gray in the toolbar and cannot add names. It used to work.

I just wanted to post this
Coincidence!

"name" field grayed out in Log and Capture

I'm using the latest version of FCP and for some reason the "name" field is grayed out in the log and capture tool. Even when i select "prompt" the clip goes untitled into the logging bin. I am capturing on the fly with no deck control. However, if i try to log a clip with deck control, the prompt works but i still can not enter a clip name in the "name" field on it's own.
any suggestions?
dual 2ghz G5 Mac OS X (10.4.9)

This is the Final Cut Express. You should try your question on the Final Cut pro forum.

Importing home recorded DVD footage not working. File names are grayed out.

I converted a VHS tape to a DVD with a machine my cousin owns. It all plays fine in DVD Player but I can't import the files into iMovie 09. All the filenames are grayed out in the import dialogue box.
How can I make it work?
Thanks in advance!
I have a "VIDEO_RM" folder with (.BUP, .IFO, .VOB, BUP, .IFO, VOB,files)
Also hav"VIDEO_TS" folder with the same types of files.... none of the files are importable into iMovie 09 and none of them seem to work inside quicktime. But they do play in my VLC player.

Thanks a lot! I will try this as soon as I can. Sorry for not finding this for myself. I did a discussion search on the subject, but not as thorough as I should of I guess.

Schema name stripped out in apex

I can get the results in SQLPlus with following query (same user as apex)but if, for example, I try and run the query below within apex I get the following error
select T_SEQ_ID, ALIGNMENT_LENGTH,
Q_SEQ_START, Q_SEQ_END, Q_FRAME, T_SEQ_START,
T_SEQ_END, T_FRAME, score, EXPECT as evalue
from TABLE(BLASTP_ALIGN (
'MHPKVDALLSRFPRITLIPWETPIQYLPRISRELGVDVYVKRDDLTGLGIGGNKIRKLEFLLGDALSRGCDTVIT
IGAVH',
CURSOR(SELECT seq_id, seq_data
FROM swissprot),
1,
-1,
0,
0,
'BLOSUM62',
10,
0,
0,
3,
0,
0)) t
where t.score > 25;
ORA-22303: type ""."DMBGOS" not found
I checked that DMBGOS is a valid type within the DMSYS schema. It seems the schema name gets stripping out in apex for some reason. Can someone take a close look at it?
Thanks,
Ke Lin

Hello,
How did you grant privileges on BLASTP_ALIGN etc to the user? Was it via a role perhaps? (That won't work in APEX, it needs to be a direct grant).
John
Blog: http://jes.blogs.shellprompt.net
Work: http://www.apex-evangelists.com
Author of Pro Application Express: http://tinyurl.com/3gu7cd
REWARDS: Please remember to mark helpful or correct posts on the forum, not just for my answers but for everyone!

Schema name while creating db link

Hi
What is schema name for sqlserver source in owb need to provided while creating db link.
reagrds
rajesh

No One to respond me??

Deployment and registration of WebServices doc

Web Services deployment and registration procedures on SOAP server are documented somewhere? How can you do this manually since JDeveloper is not handling it properly (EJBs)?
Thank you,
Cristian

I've encountered this problem too. I can successfully deploy my web-service on AS and successfully publish it on SOAP-server, but my client, uses this service, encountered a problem 'SOAP-Server: unable to resolve <name of my web-service>'. I suppose, the origin of this problem is in some paths, cuz when I place classes of my web-service in <JDeveloper_home>/j2ee/home/lib - everything works fine !

Any Function module or BAPIs are available to get scheme name for the inter

I have internal order no value in table AUFK-AUFNR , and the internal order corresponding Scheme value is available in IMPR-PRNAM . Now I want to inner join both the tables to extract the data , but there is no common field . Is there any Function module or BAPIs are available to get scheme name for the internal orders?

look at DB-VIEW "V_IVP_OR".
Regards,
Laurent

How to configure the schema name dynamically based on user input.

configure the schema name dynamically based on user input.
For ex:
We have two schemas:
Schema1 - base schema having 15 tables.
Schema2 - tables which is specific to modules. Having only 10 tables which is also available in Schema1
Login to application using Schema 1
Access a particlular module and select the country. Here country selection is identified.
Based on the country selection, we need to connect the schema respectively.
If the user selects France --> It should connect Schema1
If the user selects Germeny --> It should connect schema2.
Used: Eclipselink

You may want to have a different persistence unit for each country, then you just need to switch persistence units, and can put the schema in your orm.xml file.
You may also want to investigate EclipseLink multi-tenant support,
http://www.eclipse.org/eclipselink/documentation/2.5/jpa/extensions/a_multitenant.htm
You can the schema in a persistence unit in code using a SessionCustomizer and the tableQualifier.

Can you customize your deployment based on VM name

I know it is possible to customize your deployment by mapping your PC based on MAC or serial number using the MDT database. However, is it possible to do this by just the VM name alone? (I would think the same challenge apply to both ESX or HyperV).
If I could go ahead and create a serial of VM call VM01 to VM10, how can I have MDT deploy Task Sequence 1 to VM01 to VM05, while deploy Task Seq 2 to VM06 to VM10? As the VM doesn't have any netbios name of predefine MAC address yet ? Any idea
would be appreicated

Hi,
The answer is no, you couldn't customize deployment based on VM name.
Customize deployment by mapping PC based on MAC or serial number using MDT database is completely different with mapping PC name. The first one is based on hardware query, seconde one is based on software level.
As we know, WMI command can be used to obtain information of Computer Hardware, software, etc. While in WinPE phase, it only could be used to obtain hardware information, the command like
Get -WmiObject win32_computersystem should be works properly, but it won't be work if you try to obtain VM name by using WMI command, WinPE doesn't support these command to obtain VM name, it only works at host system. That's
to say, we didn't have method to obtain host VM name in guest machine. Therefore, if you try to mapping your PC based on VM name, it would be failed.
For more information about WMI, you can refer to the link below for more details:
http://msdn.microsoft.com/en-us/library/aa394585(v=vs.85).aspx
Roger Lu
TechNet Community Support

How to get the current schema name

Hi,
Can anybody please tell me how to get the current schema name, there is some inbuilt function for this,but i am not getting that. Please help me.
Thanks
Jogesh

ok folks, I found the answer at Tom's as usual.
http://asktom.oracle.com/tkyte/who_called_me/index.html
I rewrote it into a function for kicks. just pass the results of DBMS_UTILITY.FORMAT_CALL_STACK to this function and you will get back the owner of the code making the call as well some extra goodies like the name of the code and the type of code depending on the parameter. This ignores the AUTHID CURRENT_USER issues which muddles the schemaid. Quick question, does the average user always have access to DBMS_UTILITY.FORMAT_CALL_STACK or does this get locked down on some systems?
cheers,
paul
create or replace
FUNCTION SELF_EXAM (
   p_call_stack VARCHAR2,
   p_type VARCHAR2 DEFAULT 'SCHEMA'
) RETURN VARCHAR2
AS
   str_stack   VARCHAR2(4000);
   int_n       PLS_INTEGER;
   str_line    VARCHAR2(255);
   found_stack BOOLEAN DEFAULT FALSE;
   int_cnt     PLS_INTEGER := 0;
   str_caller VARCHAR2(30);
   str_name    VARCHAR2(30);
   str_owner   VARCHAR2(30);
   str_type    VARCHAR2(30);
BEGIN
   str_stack := p_call_stack;
   -- Loop through each line of the call stack
   LOOP
     int_n := INSTR( str_stack, chr(10) );
     EXIT WHEN int_cnt = 3 OR int_n IS NULL OR int_n = 0;
     -- get the line
     str_line := SUBSTR( str_stack, 1, int_n - 1 );
     -- remove the line from the stack str
     str_stack := substr( str_stack, int_n + 1 );
     IF NOT found_stack
     THEN
        IF str_line like '%handle%number%name%'
        THEN
           found_stack := TRUE;
        END IF;
     ELSE
        int_cnt := int_cnt + 1;
         -- cnt = 1 is ME
         -- cnt = 2 is MY Caller
         -- cnt = 3 is Their Caller
         IF int_cnt = 1
         THEN
            str_line := SUBSTR( str_line, 22 );
            dbms_output.put_line('->' || str_line);
            IF str_line LIKE 'pr%'
            THEN
               int_n := LENGTH('procedure ');
            ELSIF str_line LIKE 'fun%'
            THEN
               int_n := LENGTH('function ');
            ELSIF str_line LIKE 'package body%'
            THEN
               int_n := LENGTH('package body ');
            ELSIF str_line LIKE 'pack%'
            THEN
               int_n := LENGTH('package ');
            ELSIF str_line LIKE 'anonymous%'
            THEN
               int_n := LENGTH('anonymous block ');
            ELSE
               int_n := null;
            END IF;
            IF int_n IS NOT NULL
            THEN
               str_type := LTRIM(RTRIM(UPPER(SUBSTR( str_line, 1, int_n - 1 ))));
             ELSE
               str_type := 'TRIGGER';
             END IF;
             str_line := SUBSTR( str_line, NVL(int_n,1) );
             int_n     := INSTR( str_line, '.' );
             str_owner := LTRIM(RTRIM(SUBSTR( str_line, 1, int_n - 1 )));
             str_name := LTRIM(RTRIM(SUBSTR( str_line, int_n + 1 )));
          END IF;
       END IF;
   END LOOP;
   IF UPPER(p_type) = 'NAME'
   THEN
      RETURN str_name;
   ELSIF UPPER(p_type) = 'SCHEMA.NAME'
   OR    UPPER(p_type) = 'OWNER.NAME'
   THEN
      RETURN str_owner || '.' || str_name;
   ELSIF UPPER(p_type) = 'TYPE'
   THEN
      RETURN str_type;
   ELSE
      RETURN str_owner;
   END IF;
END SELF_EXAM;

Schema name not present on filename for "Save Package Spec and Body"

In versions previous to 3.0 EA, the filename defaulted to schema.object.sql when using the "Save Package Spec and Body" on the right click of the package/body. This appears to have disappeared. Also, it now defaults to the .PLS ext/type, which I prefer to save them as .SQL (which i can override, but it would be nice in the file type dropdown). Also, I had posted a suggestion about the actual file not including the schema name prefixing the object name when using the "Save Package Spec and Body". i.e. it does create or replace package reader_package instead of what it should be doing which is create or replace package schema.reader_package

Would be nice indeed having the real name as default, and all supported PL/SQL types (as in the preferences) in the extensions dropdown.
As for the schema name inside, I reckon that would do damage for more users than it would do good for others. But a preference would be best of course.
K.

Using dbms_datapump package to export the schema with the schema name as pa

Hi,
I am using the pl/sql block to export schema using dbms_datapump package,Now I want to pass the scheme name as the parameter to the procedure and get the .dmp and .log files with the schema name included.
CREATE OR REPLACE PROCEDURE export
IS
h1 number;
begin
h1 := dbms_datapump.open (operation => 'EXPORT', job_mode => 'SCHEMA', job_name => 'export1', version => 'COMPATIBLE');
dbms_datapump.set_parallel(handle => h1, degree => 1);
dbms_datapump.add_file(handle => h1, filename => 'EXPDAT.LOG', directory => 'DATA_PUMP_DIR', filetype => 3);
dbms_datapump.set_parameter(handle => h1, name => 'KEEP_MASTER', value => 0);
dbms_datapump.metadata_filter(handle => h1, name => 'SCHEMA_EXPR', value => 'IN(''CHECKOUT'')');
dbms_datapump.set_parameter(handle => h1, name => 'ESTIMATE', value => 'BLOCKS');
dbms_datapump.add_file(handle => h1, filename => 'EXPDAT%U' || to_char(sysdate,'dd-mm-yyyy') || '.DMP', directory => 'DATA_PUMP_DIR', filetype => 1);
dbms_datapump.set_parameter(handle => h1, name => 'INCLUDE_METADATA', value => 1);
dbms_datapump.set_parameter(handle => h1, name => 'DATA_ACCESS_METHOD', value => 'AUTOMATIC');
dbms_datapump.start_job(handle => h1, skip_current => 0, abort_step => 0);
dbms_datapump.detach (handle => h1);
exception
when others then
raise_application_error(-20001,'An error was encountered - '||SQLCODE||' -ERROR- '||SQLERRM);
end;
Thank you in advanced
Sri

user12062360 wrote:
Hi,
I am using the pl/sql block to export schema using dbms_datapump package,Now I want to pass the scheme name as the parameter to the procedure and get the .dmp and .log files with the schema name included.
OK, please proceed to do so
>
CREATE OR REPLACE PROCEDURE export
IS
h1 number;
begin
h1 := dbms_datapump.open (operation => 'EXPORT', job_mode => 'SCHEMA', job_name => 'export1', version => 'COMPATIBLE');
dbms_datapump.set_parallel(handle => h1, degree => 1);
dbms_datapump.add_file(handle => h1, filename => 'EXPDAT.LOG', directory => 'DATA_PUMP_DIR', filetype => 3);
dbms_datapump.set_parameter(handle => h1, name => 'KEEP_MASTER', value => 0);
dbms_datapump.metadata_filter(handle => h1, name => 'SCHEMA_EXPR', value => 'IN(''CHECKOUT'')');
dbms_datapump.set_parameter(handle => h1, name => 'ESTIMATE', value => 'BLOCKS');
dbms_datapump.add_file(handle => h1, filename => 'EXPDAT%U' || to_char(sysdate,'dd-mm-yyyy') || '.DMP', directory => 'DATA_PUMP_DIR', filetype => 1);
dbms_datapump.set_parameter(handle => h1, name => 'INCLUDE_METADATA', value => 1);
dbms_datapump.set_parameter(handle => h1, name => 'DATA_ACCESS_METHOD', value => 'AUTOMATIC');
dbms_datapump.start_job(handle => h1, skip_current => 0, abort_step => 0);
dbms_datapump.detach (handle => h1);
exception
when others then
raise_application_error(-20001,'An error was encountered - '||SQLCODE||' -ERROR- '||SQLERRM);
end;
EXCEPTION handler is a bug waiting to happen.
eliminate it entirely

OWB 10.1 Deploy Mgr. - Registration - schema name is grayed out, sometimes

Similar Messages

Maybe you are looking for