URGENT:ASM coding problem

The following code inputs a string frm the user and then displays it back. I need to compare the user-inputted string (whose address is saved in DS:DX) with a String "HI". If the strings match, then "Success!!!" should be printed else the control should return to the OS. I have run the code in the emulator 8086.
the problem is that the comparison is not taking place,and the "success!!" is printed irrespective of the input string... kindly assist me...
org 100h
.data
OurBuff db 00h, 00h
FirstS db 13, 10, "Please Enter a String: $"
SecondS db 13, 10, "Entered String was: $"
Success db 13, 10, "Success!!$"
.code
mov ax, @DATA
mov ds, ax
mov dx, offset FirstS
mov ah, 09h
int 21h
mov bx, offset OurBuff
mov dx, bx
mov byte [bx], 33
mov ah, 0Ah
int 21h
mov dx, offset SecondS
mov ah, 09h
int 21h
mov al, [bx+1]
add al, 02h
xor ah, ah
mov si, ax
mov byte [bx+si], '$'
mov dx, offset OurBuff
add dx, 02h
mov ah, 09h
int 21h
mov ax, dx
cmp ax, "HI"
je print
print:
mov dx, offset Success
mov ah, 09h
int 21h
jmp exit
exit:
ret
Message was edited by: 10may.agn03

mov ax, dx
cmp ax, "HI"
je print
jmp exit
print:
mov dx, offset Success
mov ah, 09h
int 21h

Similar Messages

  • ASM shutdown problem

    Hi experts,
    suddenly I faced ASM shutdown problems on a 2 node RAC. While trying to reboot the second node the resource ora.asm can't be shut down.
    After 10 minutes the shutdown of ASM times out. There is an interesting line in the ohasd.log saying that ASM can't be shut down due to error code: 3.
    Does anyone knows what this means? I googled hours and hours without any success, even in MOS I found no further informations.
    Help is greatly appreciated!!!!!!
    Thanks a lot
    Volker
    P.S. My environment:
    - 2 node RAC OEL 6.3
    - 11.2.0.4 Oracle Enterprise Edition

    Hi gurus,
    I noticed that the shutdown of the ASM instance went wrong as part of the OHAS. Unfortunately I have no error stack except this numerical error written in the ohasd.log.
    Below you can find an excerpt of the ohasd.log:
    2013-11-15 00:44:12.730: [
    AGFW][2791917312]{0:0:124} Received the reply to the message: RESOURCE_STOP[ora.asm 1 1] ID 4099:724 from the agent /u01/app/11.2.0.4/grid/bin/oraagent_oracle
    2013-11-15 00:44:12.731: [
    AGFW][2791917312]{0:0:124} Agfw Proxy Server sending the reply to PE for message:RESOURCE_STOP[ora.asm 1 1] ID 4099:723
    2013-11-15 00:44:12.731: [   CRSPE][2781411072]{0:0:124} Received reply to action [Stop] message ID: 723
    2013-11-15 00:44:12.731: [
    INIT][2781411072]{0:0:124} {0:0:124} Created alert : (:CRSPE00111:) :  Stop action timed out!
    2013-11-15 00:44:12.731: [   CRSPE][2781411072]{0:0:124} Stop action failed with error code: 3
    2013-11-15 00:44:12.732: [
    AGFW][2791917312]{0:0:124} Received the reply to the message: RESOURCE_STOP[ora.asm 1 1] ID 4099:724 from the agent /u01/app/11.2.0.4/grid/bin/oraagent_oracle
    2013-11-15 00:44:12.732: [
    AGFW][2791917312]{0:0:124} Agfw Proxy Server sending the last reply to PE for message:RESOURCE_STOP[ora.asm 1 1] ID 4099:723
    2013-11-15 00:44:12.732: [   CRSPE][2781411072]{0:0:124} Received reply to action [Stop] message ID: 723
    2013-11-15 00:44:12.732: [   CRSPE][2781411072]{0:0:124} RI [ora.asm 1 1] new internal state: [STABLE] old value: [STOPPING]
    2013-11-15 00:44:12.732: [   CRSPE][2781411072]{0:0:124} CRS-2675: Stop of 'ora.asm' on 'rac2' failed
    2013-11-15 00:44:12.733: [   CRSPE][2781411072]{0:0:124} RI [ora.asm 1 1] new internal state: [CLEANING] old value: [STABLE]
    2013-11-15 00:44:12.733: [   CRSPE][2781411072]{0:0:124} Sending message to agfw: id = 925
    2013-11-15 00:44:12.733: [   CRSPE][2781411072]{0:0:124} CRS-2679: Attempting to clean 'ora.asm' on 'rac2'
    2013-11-15 00:44:12.733: [UiServer][2779309824]{0:0:124} Container [ Name: ORDER
    MESSAGE:
    TextMessage[CRS-2675: Stop of 'ora.asm' on 'rac2' failed]
    MSGTYPE:
    TextMessage[1]
    OBJID:
    TextMessage[ora.gpnpd]
    WAIT:
    TextMessage[0]
    There are other error messages as well telling that one have to wait for the shutdown of the ASM instance. But no one is telling me the reason for that.
    Regards
    Volker

  • Asm has problem

    hi all
    i have rac 11.2 rhe5 over asm
    database stopped running
    as i guess asm has problem. i can read and write files on it but oracle instance cant
    i tride to restart resource but i have an eroor
    CRS-0223: Resource x has placement error.
    can someone help me ?

    b. altert log
    </txt>
    </msg>
    <msg time='2011-02-23T22:46:52.617+04:00' org_id='oracle' comp_id='rdbms'
    type='UNKNOWN' level='16' host_id='racnode1.mia.ge'
    host_addr='10.30.0.80'>
    <txt>
    Fatal NI connect error 12547, connecting to:
    (DESCRIPTION=(ADDRESS=(PROTOCOL=beq)(PROGRAM=/u01/app/11.2.0/grid/bin/oracle)(ARGV0=oracle+ASM1_asmb_mia1)(ENVS=&apos;ORACLE_HOME=/u01/app/11.2.0/grid,ORACLE_SID=+ASM1&apos;)(ARGS=&apos;(DE
    SCRIPTION=(LOCAL=YES)(ADDRESS=(PROTOCOL=beq)))&apos;))(enable=setuser)(CONNECT_DATA=(CID=(PROGRAM=oracle)(HOST=racnode1.mia.ge)(USER=oracle))))
    </txt>
    </msg>
    <msg time='2011-02-23T22:46:52.617+04:00' org_id='oracle' comp_id='rdbms'
    type='UNKNOWN' level='16' host_id='racnode1.mia.ge'
    host_addr='10.30.0.80'>
    <txt>
    VERSION INFORMATION:
    TNS for Linux: Version 11.2.0.1.0 - Production
    Oracle Bequeath NT Protocol Adapter for Linux: Version 11.2.0.1.0 - Production
    </txt>
    </msg>
    <msg time='2011-02-23T22:46:52.617+04:00' org_id='oracle' comp_id='rdbms'
    type='UNKNOWN' level='16' host_id='racnode1.mia.ge'
    host_addr='10.30.0.80'>
    <txt> Time: 23-FEB-2011 22:46:52
    </txt>
    </msg>
    <msg time='2011-02-23T22:46:52.617+04:00' org_id='oracle' comp_id='rdbms'
    type='UNKNOWN' level='16' host_id='racnode1.mia.ge'
    host_addr='10.30.0.80'>
    <txt> Tracing not turned on.
    </txt>
    </msg>
    <msg time='2011-02-23T22:46:52.617+04:00' org_id='oracle' comp_id='rdbms'
    type='UNKNOWN' level='16' host_id='racnode1.mia.ge'
    host_addr='10.30.0.80'>
    <txt> Tns error struct:
    </txt>
    </msg>
    <msg time='2011-02-23T22:46:52.617+04:00' org_id='oracle' comp_id='rdbms'
    type='UNKNOWN' level='16' host_id='racnode1.mia.ge'
    host_addr='10.30.0.80'>
    <txt> ns main err code: 12547
    </txt>
    </msg>
    <msg time='2011-02-23T22:46:52.617+04:00' org_id='oracle' comp_id='rdbms'
    type='UNKNOWN' level='16' host_id='racnode1.mia.ge'
    host_addr='10.30.0.80'>
    <txt>
    </txt>
    </msg>
    <msg time='2011-02-23T22:46:52.617+04:00' org_id='oracle' comp_id='rdbms'
    type='UNKNOWN' level='16' host_id='racnode1.mia.ge'
    host_addr='10.30.0.80'>
    <txt>TNS-12547: TNS:lost contact
    </txt>
    </msg>
    <msg time='2011-02-23T22:46:52.617+04:00' org_id='oracle' comp_id='rdbms'
    type='UNKNOWN' level='16' host_id='racnode1.mia.ge'
    host_addr='10.30.0.80'>
    <txt> ns secondary err code: 12560
    </txt>
    </msg>
    <msg time='2011-02-23T22:46:52.617+04:00' org_id='oracle' comp_id='rdbms'
    type='UNKNOWN' level='16' host_id='racnode1.mia.ge'
    host_addr='10.30.0.80'>
    <txt> nt main err code: 517
    </txt>
    </msg>
    <msg time='2011-02-23T22:46:52.618+04:00' org_id='oracle' comp_id='rdbms'
    type='UNKNOWN' level='16' host_id='racnode1.mia.ge'
    host_addr='10.30.0.80'>
    <txt>
    </txt>
    </msg>
    <msg time='2011-02-23T22:46:52.618+04:00' org_id='oracle' comp_id='rdbms'
    type='UNKNOWN' level='16' host_id='racnode1.mia.ge'
    host_addr='10.30.0.80'>
    <txt>TNS-00517: Lost contact
    </txt>
    </msg>
    <msg time='2011-02-23T22:46:52.618+04:00' org_id='oracle' comp_id='rdbms'
    type='UNKNOWN' level='16' host_id='racnode1.mia.ge'
    host_addr='10.30.0.80'>
    <txt> nt secondary err code: 32
    </txt>
    </msg>
    <msg time='2011-02-23T22:46:52.618+04:00' org_id='oracle' comp_id='rdbms'
    type='UNKNOWN' level='16' host_id='racnode1.mia.ge'
    host_addr='10.30.0.80'>
    <txt> nt OS err code: 0
    </txt>
    </msg>
    <msg time='2011-02-23T22:46:52.618+04:00' org_id='oracle' comp_id='rdbms'
    client_id='' type='UNKNOWN' level='16'
    host_id='racnode1.mia.ge' host_addr='10.30.0.80' module=''
    pid='4554'>
    <txt>ERROR: Failed to connect with connect string: (DESCRIPTION=(ADDRESS=(PROTOCOL=beq)(PROGRAM=/u01/app/11.2.0/grid/bin/oracle)(ARGV0=oracle+ASM1_asmb_mia1)(ENVS=&apos;ORACLE_HOME=/u01/app
    /11.2.0/grid,ORACLE_SID=+ASM1&apos;)(ARGS=&apos;(DESCRIPTION=(LOCAL=YES)(ADDRESS=(PROTOCOL=beq)))&apos;))(enable=setuser))
    </txt>
    </msg>

  • Three new bioinformatic coding problems now in WIKI (all require regex)

    At the bottom of this page:
    https://wiki.sdn.sap.com/wiki/display/EmTech/Bio-InformaticBasicsInRelationtoScriptingLanguages
    I've defined three new bioinformatic coding problems (Problems 3a-c).
    These all involve regex parsing in one way or another and are therefore a lot more interesting than the first two problems I've presented.
    I'm hoping that Anton will continue to knock out solutions, and that others will feel challenged enough to join him.
    djh

    Anton -
    I am way impressed - not just by your code and how fast you produced it, but also by the speed with which you grasped the STRIDE documentation and put it to very good use.
    Regarding the question you ask at the very end - this question goes to the heart of why protein tertiary structure (the actual 3-dimensional shape of one chain of a protein) is so hard to predict, and why governments, universities, and pharma are throwing so much money at it.
    If protein primary and secondary structure were many-to-one, prediction of protein tertiary strructure would be a lot lot simpler.  (For example, if "VVAY" and all "similar" primary structure subsequences mapped to the same secondary structure.)
    But the mapping is, unfortunately, many-to-many because the amino acids (AAs) in a primary structure chain always bond the same way - the COOH (carboxy) of one  AA bonds to the HN (amino) of the next one to produce C-N with the OH and H going away to make a water moleculre ... COOH - HN ---> C-N + H20.
    And as pointed out by Linus Pauling (the discoverer of protein secondary structure), the C-N bond can take two forms:
    a) one that is llkely to force the two amino acids to become HH (part of a helix)
    b) one that is likely to force the two amino acids to become EE (part of a "stand")
    You may be surprised to find out that even primary structure subsequences of six amino acids can wind up as different secondary structures - not always "H" vs "E", the variants might be
    E TT H
    H TT E
    EEE HH
    HH EEE
    etc.
    Anyway, thanks a lot for what you've done here.
    If you decide to stay involved a little longer, you will very soon be able to understand why there may be real promise in the approach to protein structure that is being taken here:
    http://strucclue.ornl.gov
    (This is why I want to get SAP interested in the vertical bioinformatic sector - you can see why an integrated IDE with a robust DB is so important.)
    BTW, the site mentions Dr. Arthur Lesk as a team member.  Arthur is considered one of the fathers of what is called "structural alignment" (as opposed to pure sequence alignment.)
    If you Google him, you'll see that he has written many many books on bioinformatics - all worth purchasing if you're going to become involved in this area.  Arthur was at Cambridge (MRC) until recently, when he reached mandatory EU retirement age and took a position at Penn State here in the US.
    Best
    djh

  • Coding problem with my website

    On my website, rockycapellaprods.com, I have a coding problem with the labeling of the videos as well as the videos playing on the website. Everything works great on the IWEB site, but as I loaded the information on the GoDaddy hosting site, several pages have a problem with the playing the videos and having several of the images moving onto the written areas. Do you have any solutions so the videos and the images stay on the website where I set them up?

    this would be a problem with style sheets or CSS and common with iFrames. If you have a fixed width for the body on your page template, you will have varying results of layout when you view the page.
    If you have your editor stretched to a certain width across your screen, you will likely be able to layout all your text blocks and objects into the places you want which may or may not ignore the "width" restrictions of the body. when you upload the site and open it in a browser, the layout could change because of the width restrictions in the HTML or CSS code and thus "wrap" to the next line.
    THe solution is to be familiar with static and fixed positioning of text and objects within your page. Be familiar with text that wraps around images, or images placed within a text box, etc. How your images and text react in relation to each other is all part of the code for the objects, text, and body parameters combined.
    I'm sorry there isnt a fast fix for this, and it would literally be an extended lesson posted here online to take you thru understanding the code, how it works, what its affects are, style sheets, template restrictions and so on. One thing you can do is stretch the browser window open more to see if your objects align themselves similar to what you saw in iWeb editor. if it does, your template is set to "percentage of page width" for the body of the page.
    Message was edited by: iRocket
    Message was edited by: iRocket

  • Coding Problem 6 Now Defined in Scripting Languages/Bioinformatics WIKI

    In the "Scripting Languages and Bioinformatics" WIKI, I have completed a new page here:
    https://wiki.sdn.sap.com/wiki/display/EmTech/Bio-InformaticBasicsPartII-AlignmentToolsforRelatingProteinGenestoProteinPrimaryStructures
    and also defined Coding Problem 6 at the end of this page.
    This problem involves scripting an interactive session with a web site and parsing what the web site returns at various points duing the session.
    Am looking foward to a script that solves this problem, if anyone feels like spending the time to do it.

    <?
    // sequence to search ---------------------------------------------
    $bquery      = "MTQIIKIDPLNPEIDKIKIAADVIRNGGTVAFPTETVYGLGANAFDG";
    $bquery     .= "NACLKIFQAKNRPVDNPLIVHIADFNQLFEVAKDIPDKVLEIAQIVW";
    $bquery     .= "PGPLTFVLKKTERVPKEVTAGLDTVAVRMPAHPIALQLIRESGVPIA";
    $bquery     .= "APSANLATRPSPTKAEDVIVDLNGRVDVIIDGGHTFFGVESTIINVT";
    $bquery     .= "VEPPVLLRPGPFTIEELKKLFGEIVIPEFAQGKKEAEIALAPGMKYK";
    $bquery     .= "HYAPNTRLLLVENRNIFKDVVSLLSKKYKVALLIPKELSKEFEGLQQ";
    $bquery     .= "IILGSDENLYEVARNLFDSFRELDKLNVDLGIMIGFPERGIGFAIMN";
    $bquery     .= "RARKASGFSIIKAISDVYKYVNI";
    // url for form1 --------------------------------------------------
    $url = "http://blast.ncbi.nlm.nih.gov:80/Blast.cgi";
    // parameters for form1 -------------------------------------------
    $bdb         = "protein";
    $bgeneticcode= "1";
    $bquery_from = "";
    $bquery_to   = "";
    $bjobtitle   = "ACW-" . time();
    $bdatabase   = "nr";
    $bblastprog  = "tblastn";
    $bpagetype   = "BlastSearch";
    $pf  = "";
    $pf .= "QUERY=" . $bquery;
    $pf .= "&db=" . $bdb;
    $pf .= "&QUERY_FROM=" . $bquery_from;
    $pf .= "&QUERY_TO=" . $bquery_to;
    $pf .= "&JOB_TITLE=" . $bjobtitle;
    $pf .= "&DATABASE=" . $bdatabase;
    $pf .= "&BLAST_PROGRAMS=" . $bblastprog;
    $pf .= "&PAGE_TYPE=" . $bpagetype;
    $pf .= "&GENETIC_CODE=1";
    $pf .= "&DBTYPE=";
    $pf .= "&EQ_MENU=";
    $pf .= "&EQ_TEXT=";
    $pf .= "&NEWWIN=";
    $pf .= "&MATCH_SCORES=";
    $pf .= "&MAX_NUM_SEQ=100";
    $pf .= "&EXPECT=10";
    $pf .= "&WORD_SIZE=3";
    $pf .= "&MATRIX_NAME=BLOSUM62";
    $pf .= "&GAPCOSTS=11 1";
    $pf .= "&COMPOSITION_BASED_STATISTICS=2";
    $pf .= "&REPEATS=";
    $pf .= "&FILTER=";
    $pf .= "&LCASE_MASK=";
    $pf .= "&TEMPLATE_LENGTH=";
    $pf .= "&TEMPLATE_TYPE=";
    $pf .= "&I_THRESH=0.005";
    $pf .= "&CLIENT=web";
    $pf .= "&SERVICE=plain";
    $pf .= "&CMD=request";
    $pf .= "&PAGE=Translations";
    $pf .= "&PROGRAM=tblastn";
    $pf .= "&MEGABLAST=";
    $pf .= "&RUN_PSIBLAST=";
    $pf .= "&SELECTED_PROG_TYPE=tblastn";
    $pf .= "&SAVED_SEARCH=true";
    $pf .= "&BLAST_SPEC=";
    $pf .= "&QUERY_BELIEVE_DEFLINE=";
    $pf .= "&DB_DIR_PREFIX=";
    $pf .= "&SHOW_OVERVIEW=true";
    $pf .= "&SHOW_LINKOUT=true";
    $pf .= "&GET_SEQUENCE=true";
    $pf .= "&FORMAT_OBJECT=Alignment";
    $pf .= "&FORMAT_TYPE=HTML";
    $pf .= "&ALIGNMENT_VIEW=Pairwise";
    $pf .= "&MASK_CHAR=2";
    $pf .= "&MASK_COLOR=1";
    $pf .= "&DESCRIPTIONS=100";
    $pf .= "&ALIGNMENTS=100";
    $pf .= "&NEW_VIEW=true";
    $pf .= "&OLD_BLAST=true";
    $pf .= "&NCBI_GI=false";
    $pf .= "&SHOW_CDS_FEATURE=false";
    $pf .= "&NUM_OVERVIEW=100";
    $pf .= "&FORMAT_EQ_TEXT=";
    $pf .= "&FORMAT_ORGANISM=";
    $pf .= "&EXPECT_LOW=";
    $pf .= "&EXPECT_HIGH=true";
    $pf .= "&QUERY_INDEX=0";
    // define the HTTP connection -----------------------------
    $ch = curl_init();
    curl_setopt($ch,CURLOPT_URL,$url);
    curl_setopt($ch, CURLOPT_POST, 1);
    curl_setopt($ch,CURLOPT_POSTFIELDS, $pf);
    curl_setopt($ch,CURLOPT_COOKIEJAR,
    dirname(__FILE__).'/cookie.txt');
    curl_setopt($ch,CURLOPT_FOLLOWLOCATION,1);
    curl_setopt($ch, CURLOPT_HEADER , 1);
    curl_setopt($ch, CURLOPT_RETURNTRANSFER,1);
    // call it ------------------------------------------------
    $my_result = curl_exec($ch);
    // get the request ID; the query takes some time and this ID
    // allows to identify the original request
    $query = "/<tr><td>Request ID<\/td><td> <b>([0-9A-Z]*)<\/b><\/td><\/tr>/";
    preg_match($query, $my_result, $request_id);
    // query for the result page every 2 seconds...when the result
    // is ready, we recognize it by its signature
    $not_ready = true;
    $result_url = "http://blast.ncbi.nlm.nih.gov/Blast.cgi?CMD=Get&VIEW_RESULTS=FromRes&RID=" . $request_id[1];
    while($not_ready){
      $temp_page = null;
      curl_setopt($ch,CURLOPT_URL,$result_url);
      curl_setopt($ch, CURLOPT_POST, 0);
      $my_result = curl_exec($ch);
      $query = "/This page will be automatically updated in <b>(\d*)<\/b> seconds/";
      preg_match($query, $my_result, $temp_page);
      if(isset($temp_page[1])) {  sleep(2); }
      else { $not_ready = false; }
    // parse the results page; split it into result fragments first --------
    $pat = "/";
    $pat .= "><input type=\"checkbox\" name=\"getSeqGi\"([^\n]*)\n";
    $pat .= "Length=\d*\n\n";
    $pat .= "[\w\s]*:\n";
    $pat .= "(\s*<a[^>]*>[^<]*<\/a>\n)*\n";
    $pat .= "([^\n]*\n){3}\n";
    $pat .= "(([^\n]*\n){3}\n[^n])*";
    $pat .= "/";
    preg_match_all($pat, $my_result, $fragments);
    // 'fine parse the result fragments and get some important parameters -----
    foreach($fragments[0] as $fragment){
      $query = "/<a href=\"http:\/\/(www\.ncbi\.nlm\.nih\.gov\/entrez\/query\.fcgi\?";
      $query .= "[^>]*)>([^<]*)<\/a><a[^>]*>[^<]*<\/a>\s*<a[^>]*><img[^>]*><\/a>([^\n]*)/";
      preg_match($query, $fragment, $u);
      $query  = "/\s*Score\s*=\s*(\d*) bits\s*\(\d*\),\s*Expect\s*=\s*([^,]*),";
      $query .= "[^\n]*\n\s*Identities\s*=\s*\d*\/\d*\s*\((\d*%)\)[^\n]*\n\s*Frame\s*=\s*([^\n]*)\n/";
      preg_match($query, $fragment, $u1);
      preg_match_all("/Sbjct\s*(\d*)\s*[A-Z\-]*\s*(\d*)\n/", $fragment, $positions);
      $fr["url"]        = $u[1];
      $fr["shname"]     = $u[2];
      $fr["name"]       = $u[3];
      $fr["score"]      = $u1[1];
      $fr["expect"]     = $u1[2];
      $fr["identities"] = $u1[3];
      $fr["frame"]      = $u1[4];
    // find out if we have to reverse the strand direction or not; adjust
    // lower and upper limit
      if ($fr["frame"] >= 0) {
        $fr["high"] =  $positions[2][count($positions)-1]; $fr["low"] = $positions[1][0]; $fr["reverse"] = ""; }
      else {
        $fr["high"] =  $positions[1][0]; $fr["low"] = $positions[2][count($positions)-1]; $fr["reverse"] = true;}
      $frx[] = $fr;
    // we call the final details form for the top ranked result
    // here we could loop over several results
    curl_setopt($ch,CURLOPT_URL,$frx[0]["url"]);
    curl_setopt($ch, CURLOPT_POST, 0);
    $my_result = curl_exec($ch);
    // parse the final details form to get the necessary parameters to execute
    // the final details form
    preg_match("/<input name=\"WebEnv\" type=\"hidden\" value=\"([^\"]*)\"/",
               $my_result, $u5);
    preg_match("/<input name=\"query_key\" type=\"hidden\" value=\"([^\"]*)\"/",
               $my_result, $u6);
    preg_match("/<input name=\"db\" type=\"hidden\" value=\"([^\"]*)\"/",
               $my_result, $u7);
    preg_match("/<input name=\"qty\" type=\"hidden\" value=\"([^\"]*)\"/",
               $my_result, $u8);
    preg_match("/<input name=\"c_start\" type=\"hidden\" value=\"([^\"]*)\"/",
               $my_result, $u9);
    preg_match(
      "/<select name=\"dopt\".*<option value=\"([^\"]*)\" selected=\"1\">/",
      $my_result, $u10);
    preg_match(
      "/<select name=\"dispmax\".*<option value=\"([^\"]*)\" selected=\"1\">/",
      $my_result, $u11);
    preg_match(
      "/<select name=\"sendto\".*<option value=\"([^\"]*)\" selected=\"1\">/",
      $my_result, $u12);
    preg_match(
      "/<input type=\"hidden\" id=\"([^\"]*)\" name=\"fmt_mask\".*value=\"([^\"]*)\"/",
      $my_result, $u13);
    preg_match(
      "/<input type=\"checkbox\" id=\"truncate\" name=\"truncate\" value=\"([^\"]*)\"\/>/",
      $my_result, $u14);
    // fill in the necessary parameters parsed out now and earlier
    $of  = "WebEnv=" . $u5[1];
    $of .= "&query_key=" . $u6[1];
    $of .= "&db=" . $u7[1];
    $of .= "&qty=" . $u8[1];
    $of .= "&c_start=" . $u9[1];
    $of .= "&dopt=" . $u10[1];
    $of .= "&dispmax=" . $u11[1];
    $of .= "&sendto=" . $u12[1];
    $of .= "&fmt_mask=" . $u13[1];
    $of .= "&truncate=" . $u14[1];
    $of .= "&less_feat=";
    $of .= "&from=" . $fr["low"];
    $of .= "&to=" . $fr["high"];
    $of .= "&strand=" . $fr["reverse"];
    $of .= "&extrafeatpresent=1";
    $of .= "&ef_SNP=1";
    $of .= "&ef_CDD=8";
    $of .= "&ef_MGC=16";
    $of .= "&ef_HPRD=32";
    $of .= "&ef_STS=64";
    $of .= "&ef_tRNA=128";
    $of .= "&ef_microRNA=256";
    $of .= "&ef_Exon=512";
    $of .= "&submit=Refresh";
    $ourl = "http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?" . $of;
    // execute the final details form
    curl_setopt($ch,CURLOPT_URL,$ourl);
    curl_setopt($ch, CURLOPT_POST, 0);
    curl_setopt($ch,CURLOPT_POSTFIELDS, $of);
    curl_setopt($ch,CURLOPT_FOLLOWLOCATION,1);
    curl_setopt($ch, CURLOPT_HEADER , 1);
    curl_setopt($ch, CURLOPT_RETURNTRANSFER,1);
    $my_result = curl_exec($ch);
    // parse the result page and get the final ORIGIN snippet
    preg_match("/ORIGIN\s*\n\s*<a name=\"[^\"]*\"><\/a>\s*([^\/]*)\//", $my_result, $u99);
    // output the final result ----------------------------------
    echo "\n" . preg_replace("/\s{2,}/", "\n", preg_replace("/\d+\s/", "", $u99[1]));
    ?>
    Edited by: Anton Wenzelhuemer on Aug 6, 2008 8:08 PM (Re-Formatted)

  • Oracle 12c ASM Disk Problem on AIX

    Hi All,
    We need to install 12.1.0.2 DB with ASM option on AIX 7.1. When we start to install 12.1.0.2 grid installation, in the 3.step we could not show adding Candidate disks to ASM. Disks right are 660 and oracle:oinstall ownership.
    When we start to install 11gR2 installation on same platform we can see the Candidate Disk, and We can install 11gR2 ASM+DB on same platform. But for 12.1.0.2 is not.
    How can we add Candidate Disks to 12c ASM İnstallation for below step ? The disks which is not shown for this step are like below. After first error I have changed disks' ownership like oracle:asmadmin, it isn't solved. I need urgent help.

    Hi Sve,
    Thanks for replying me. What you have written are tried but not works. I have solved problem.
    The problem is related AIX platform. I have Solved problem with below steps.
    1- I have installed grid infrastructure with Software Only option.
    2- After install Software Only Standalone Grid, I have tried to install manually ASM instance. But I have taken this error. rtld: 0712-001 Symbol CreateIoCompletionPort was referenced and it is solved with this MOSC ID: Doc ID1949184.1)
    3- After Successfull 2.step you can now install ASM manually from asmca.

  • Urgent!!  Problems muxing .m2v files and audio!! MPEG Streamclip/Compressor

    Hello!
    I am under an urgent deadline to upload a short 6 min documentary clip for a client to review for screening this week. The footage was shot in 1080/60i HDV.
    Usually, I find the best quality and fastest way to do this is to export directly from my FCP sequence using the '150 min Best Quality' DVD settings in compressor to get an .m2v video file and .ac3 audio file. Then I open the .m2v files in MPEG Streamclip which links it with my .ac3 file, then do 'Export MPEG with MP-2 audio". This gives me a single, muxed file that I can then upload to YouTube or Vimeo.
    However, with this project, when I open up my .m2v file in MPEG Streamclip, it's recognizing the .ac3 file and I can see the info for it in the MPEG Streamclip window, but when I play the file in MPEG Streamclip or mux it, I don't hear any audio. Furthermore, after about 5 seconds into the clip, the playhead will continue moving, but the video will freeze, then maybe pick up again later. The .m2v video will play back smoothly in VLC player or Quicktime player, but not in MPEG Streamclip.
    I've tried exporting different little sections of the timeline to see if maybe I had some corrupted footage or whatnot. I even exported a small clip from an older HDV project to test. But no matter where I export from, I am running into the same problem. I can bring the .m2v file and .ac3 file into DVD Studio Pro and burn a DVD with no problem, but I can't mux them. If I build the DVD file in DVD SP and try to open the .VOB file with MPEG Streamclip, I get the same problem. I even tried using a different software to mux (ffmpegX) but to no avail. When I try with ffmpegX, it either tells me I'm dropping frames, or if it works and it muxes it, when I open the MPEG file, it'll stutter at about 5 seconds in as well and I can't hear any audio, even though there is supposed to be audio in the muxed file.
    I think I might have updated my Quicktime a few days ago with the system update, and maybe updated a few other things, so I don't know if this has any bearing on the problems I'm running into. But I was able just a few days ago to export HDV 1080/60i using this workflow without any problems.
    I realize I have other export options, but this always seems to me to be the best quality and fastest way of doing it vs. encoding an H.264 which, on my machine is RIDICULOUSLY slow...I need to be uploading multiple versions of the cut to the client, and really need help! Thanks so much in advance!
    J

    what you want is an m2v program file. Export a reference copy from FCP (uncheck Make Movie Self Contained") That's very fast. Bring it into Compressor. In the settings panel find the MPEG-2 settings folder. Select Program Stream. Adjust to your liking and run. The audio and video will already be "muxed" when it's done and using compressor 3 you can set it to upload to YouTube, Mobile or similar sites.

  • HELP!!!  can't get my site uploaded to the host due to some coding problem.

    have publish to folder from my iweb. intended to upload files to other hosting company. Downloaded Cyberduck to FTP file for the uploading. But have a problem as the hosting staff says that my files are loaded correctly but doesn't show probably due to some coding needs to be done to index.html. I've no idea how to do coding and the staff could not assist me either. Can someone help me please?

    My thought was that this happens when you have some kind of naming conflict that interferes with the separate index.html page that iWeb creates on publishing.
    You need to keep the name of your site short, so name your site something like Site or perhaps TT for short. Rather than naming any of your pages index, name them Home, Welcome or whatever fits with your site. Don't use underscores in a name. If you have a longer page name, then just enter it with the spaces and iWeb will do the rest for you on publication.
    When you click on publish to a folder, iWeb will create one folder with your site name on it that contains all the folders and files for your site. It also creates a separate index.html file and you need to upload both of these via ftp.
    With Cyberduck, link to your space and click on action at the top and upload. Upload the whole of your site folder (don't upload the pages separately, or they will be in the incorrect order and may not be seen) and then your index.html page and then place these items into the public_html folder or it could be named www and your website should then be live.

  • WBS coding problem

    Dear all,
    I have created project mask: P-0000000-00-00 and my special characters are:
    PL SL ET Sp SP SP SP SP SP SP SP Edit ANo
    1 " / . : 1 ; - < = %
    Something is wrong with project's coding.
    I try to create new project with cj01. In the first screen I select project definition as "P-0000001". After I press "enter" system goes to the second screen and changes project definition to "P". Why?
    I had maintained validation and substitutions rules before and executed program RGUGBR00 with all checked boxes. I suspect that might cause problem.
    Please suggest how I can correct the problem

    Approach 1
    If you have deactivated validation / substitution rule related to the Project coding mask. Than once again run  the same progrogram with similar parameter. &  try.
    If you are  still getting any error / warning message  realted to validation / sustitution rule  than let us know.
    Ask ABAP via running which programme you can deactivae ABAP coding for the validation & sustituion rule.
    Approach 2
    Altenatively take help of ABAP Guy & use TXn GGB4 for the validation / sustitution anaysis.
    GGB4--> activate validation/sustation > Select PS radio button>click on validation> Project structure radio button> give the project no execute.
    If you are in testing system than only you use GGB4.
    Hope may get some sort of help  out of it.
    Regards
    Nitin
    Edited by: Nitin  Patoliya on Dec 2, 2008 8:50 PM

  • Very Urgent?Facing Problems With Labels

    Hi All,
    It's Very Urgent,In My VC Application
    Label Have More Than 15 Characters
    I PUT Label Layout  To Long Label.
    My Label Name  online assignement date
    But Even Put Long Label, online ***.......
    Please Resolve The Problem ASAP.
    Thanks
    SubbaRao Chinta

    Hi Subbu,
    I told u already its an Know issue with Flex compiler ,Even u set the label to long label it will show u only short label.
    This issue is fixed with Flex2 compiler.
    Use Flex2 compiler for ur application then it will dispaly the total label u want display.
    Regards,
    Govindu

  • Urgent Sql Query Problem - -Very Urgent

    Hi Guys,
    I need a urgent solution for a problem.I am
    using the following query
    select ename from emp where deptno =10
    Now I will declare a bind variable and if user passes 'A'
    then the query will run as it is and if he passes B
    then it should run the above query with this additional clause -> birthdate - hiredate >15.
    Please can any one help its very urgent

    Assuming that you have a birthdate column in your emp table, the following will do what you are asking for:
    VARIABLE bind_var VARCHAR2(1)
    EXECUTE :bind_var := '&bind_variable'
    SELECT ename FROM
    (SELECT 'A' AS selection, ename FROM emp WHERE deptno = 10
    UNION ALL
    SELECT 'B' AS selection, ename FROM emp WHERE deptno = 10 AND birthdate - hiredate > 15)
    WHERE selection = :bind_var
    However, the clause "birthdate - hiredate > 15" will only retrieve rows for employees who were born more than 15 days after they were hired. I doubt that this is what you really want, since this is impossible.

  • Coding problem in a user exit for unit conversion please see it once

    Hi experts,
                   i am having a problem in coding i wont to convert the MSEG-ERFME field that is quantity field into tonne when ever it is kg. In tcode j1i5 i got one user exit J_1i7_userexit_validate now inside this user exit i have to write this code that when ever the UOM(unit of measure)ERFME comes in KG it should be converted into TONNE, This code is to be written in the user exit and has to be followed forward in other values.
    Thanks
    sumeet Malhotra

    Hi Experts,
                Have any one used this Function module unit_conversion_simple please help Not getting any reply since tmmrow,I am not able to get the desired output wont to convert all KG inputs into Tonne.
    this is the code part
    CALL FUNCTION 'UNIT_CONVERSION_SIMPLE'
       EXPORTING
         INPUT                      = ERFMG  " QUANTITY
       NO_TYPE_CHECK              = 'X'
       ROUND_SIGN                 = ' '
        UNIT_IN                    = ERFME  " ORIGINAL UOM WHICH EXIST
        UNIT_OUT                   = 'TO'   " UOM REQUIRED
    IMPORTING
       ADD_CONST                  =
       DECIMALS                   =
       DENOMINATOR                = 1000
       NUMERATOR                  =
        OUTPUT                     =   RESULT "OUTPUT
    EXCEPTIONS
       CONVERSION_NOT_FOUND       = 1
       DIVISION_BY_ZERO           = 2
       INPUT_INVALID              = 3
       OUTPUT_INVALID             = 4
       OVERFLOW                   = 5
       TYPE_INVALID               = 6
       UNITS_MISSING              = 7
       UNIT_IN_NOT_FOUND          = 8
       UNIT_OUT_NOT_FOUND         = 9
       OTHERS                     = 10
    IF SY-SUBRC <> 0.
    MESSAGE ID SY-MSGID TYPE SY-MSGTY NUMBER SY-MSGNO
            WITH SY-MSGV1 SY-MSGV2 SY-MSGV3 SY-MSGV4.
    ENDIF.
    Please help
    Thanks
    Edited by: sumeet malhotra on Feb 7, 2009 5:46 AM

  • Help urgently needed: bizarre problem - no audio in imported clip!

    Hey there!
    I have a bizarre - never the less urgent problem:
    When I import some material (presentations) which I have recorded on Mini DV with my Canon MVX10i Camcorder the following problem occurs:
    There is one particular presentation which somehow looses the audio during the import process!
    That means the imported clip has no audio even though the audfio is on tape! Other clips before and after do not have this problem - the audio is available after the import.
    A bizarre but serious problem for me. Any suggestions?
    Thanks a lot in advance
    Thorge

    I had a similar problem. When I started the tape from the beginning no audio would import. To solve it I started the tape a few seconds in and It seemed to work.
    Hope this helps.

  • URGENT: JAVA FTP problem

    Hi,
    I am trying to FTP (retreive) the files from external server, that is going through some proxy.
    I am using commons-net-1.0.0.jar file to do the FTP (FTPClient)
    2 files must be retreived (get) from that box. The local server is UNIX solaris.
    It is working fine in BC box and Dev box. The process is able to GET both the files.
    But in Production (Primary box), I am able to get only one file, and that is the smaller out of 2. Not getting the larger file.
    Program is not throwing any errors either.
    Not sure what I need to check or how to resolve this problem.
    Any help is greatly appreciated.

    There is little improvement from previous time (above mentioned problem)
    Now, first time when I run the program, it is working fine and I am getting the files back from external source.
    But if I run the program 2nd time (repeatedly) , it is not FTPing the files and program is hanging @ the retreival (FTP retreiveFile() ) part.
    i.e. If I run the program after certain gap like 3-4hrs, first time it is working fine. But starts hanging if I run 2nd time.
    Do I need to set something.
    Please help. Very urgent.
    Thanks in advance.

Maybe you are looking for