Error synchronizing text index in oracle 10g

Hi,
I am getting errors while trying to synchronize the text index on a xmltype table.
SQL> exec ctx_ddl.sync_index('CTX_INDEX');
BEGIN ctx_ddl.sync_index('CTX_INDEX'); END;
ERROR at line 1:
ORA-20000: Oracle Text error:
DRG-50857: oracle error in drsxsopen
ORA-00904: "BASE"."SYS_NC00162$"."GETCLOBVAL": invalid identifier
ORA-06512: at "CTXSYS.DRUE", line 160
ORA-06512: at "CTXSYS.CTX_DDL", line 539
ORA-06512: at line 1
I will appreciate it if someone can help me figure out a solution.
(Oracle database version - 10.2.0.1)
Thanks,
Uma

Testing with 10.2.0.2.0 I do not see the problem. Is there something significanly different between your environement and the one in this testcase
SQL*Plus: Release 10.2.0.2.0 - Production on Tue Feb 28 16:16:54 2006
Copyright (c) 1982, 2005, Oracle.  All Rights Reserved.
SQL> spool createTextIndex.log
SQL> --
SQL> connect &1/&2
Connected.
SQL> --
SQL> desc ENTRY_TABLE
Name                                      Null?    Type
TABLE of SYS.XMLTYPE(XMLSchema "http://www.uniprot.org/support/docs/uniprot.xsd" Element "entry") STORAGE Object-relational TYPE "ENTRY_T"
SQL> /
SP2-0103: Nothing in SQL buffer to run.
SQL> create index UNIPROT_FULL_TEXT
  2      on ENTRY_TABLE e (object_value)
  3         indextype is ctxsys.context
  4         parameters ( 'section group ctxsys.NULL_SECTION_GROUP' )
  5  /
Index created.
SQL> quit
Disconnected from Oracle Database 10g Enterprise Edition Release 10.2.0.2.0 - Production
With the Partitioning, OLAP and Data Mining options
SQL*Plus: Release 10.2.0.2.0 - Production on Tue Feb 28 16:16:58 2006
Copyright (c) 1982, 2005, Oracle.  All Rights Reserved.
SQL> spool loadFile_&3..log
SQL> set trimspool on
SQL> connect &1/&2
Connected.
SQL> --
SQL> set timing on
SQL> --
SQL> declare
  2    result boolean;
  3  begin
  4    result := dbms_xdb.createResource('/home/&1/&3',
  5                                      bfilename(USER,'&3'),nls_charset_id('AL32UTF8'));
  6  end;
  7  /
old   4:   result := dbms_xdb.createResource('/home/&1/&3',
new   4:   result := dbms_xdb.createResource('/home/BASE/testcase.xml',
old   5:                                     bfilename(USER,'&3'),nls_charset_id('AL32UTF8'));
new   5:                                     bfilename(USER,'testcase.xml'),nls_charset_id('AL32UTF8'));
PL/SQL procedure successfully completed.
Elapsed: 00:00:00.70
SQL> commit
  2  /
Commit complete.
Elapsed: 00:00:00.08
SQL> quit
Disconnected from Oracle Database 10g Enterprise Edition Release 10.2.0.2.0 - Production
With the Partitioning, OLAP and Data Mining options
SQL*Plus: Release 10.2.0.2.0 - Production on Tue Feb 28 16:16:59 2006
Copyright (c) 1982, 2005, Oracle.  All Rights Reserved.
SQL> spool testcase.log
SQL> --
SQL> connect &1/&2
Connected.
SQL> --
SQL> --
SQL> -- Testcase code here
SQL> --
SQL> set trimspool on
SQL> set autotrace on explain
SQL> set timing on
SQL> set pages 0 lines 140 long 100000
SQL> --
SQL> select count(*)
  2    from ENTRY_TABLE
  3  /
         1
Elapsed: 00:00:00.21
Execution Plan
Plan hash value: 4248071425
| Id  | Operation          | Name        | Rows  | Bytes | Cost (%CPU)| Time    |
|   0 | SELECT STATEMENT   |             |     1 |    20 |     3   (0)| 00:00:01 |
|   1 |  SORT AGGREGATE    |             |     1 |    20 |            |         |
|*  2 |   TABLE ACCESS FULL| ENTRY_TABLE |     1 |    20 |     3   (0)| 00:00:01 |
Predicate Information (identified by operation id):
   2 - filter(SYS_CHECKACL("ACLOID","OWNERID",xmltype('<privilege
              xmlns="http://xmlns.oracle.com/xdb/acl.xsd"
              xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance"
              xsi:schemaLocation="http://xmlns.oracle.com/xdb/acl.xsd
              http://xmlns.oracle.com/xdb/acl.xsd DAV:http://xmlns.oracle.com/xdb/dav.xs
              d"><read-properties/><read-contents/></privilege>'))=1)
Note
   - dynamic sampling used for this statement
SQL> select object_value
  2    from ENTRY_TABLE
  3   where existsNode (OBJECT_value, '/entry[accession/text()="P19084"]','xmlns="http://uniprot.org/uniprot"')>0
  4  /
*** Object defn.s out of sync w/ data
***<entry xmlns="http://uniprot.org/uniprot" dataset="Swiss-Prot" created="1990-11-01" modified="2006-02-07" version="45">
  <accession>P19084</accession>
  <name>11S3_HELAN</name>
PLTLWANRYQLSREEAQQLKFSQRETVLFAPSFSRGQGIRASR
</sequence>
</entry>
Elapsed: 00:00:03.13
Execution Plan
Plan hash value: 4171466134
| Id  | Operation                    | Name           | Rows  | Bytes | Cost (%CPU)| Time     |
|   0 | SELECT STATEMENT             |                |     1 | 10115 |   804  (1)| 00:00:10 |
|   1 |  NESTED LOOPS                |                |     1 | 10115 |   804  (1)| 00:00:10 |
|   2 |   SORT UNIQUE                |                |     1 |  2016 |   802  (0)| 00:00:10 |
|*  3 |    INDEX FAST FULL SCAN      | ACCESSION_DATA |     1 |  2016 |   802  (0)| 00:00:10 |
|*  4 |   TABLE ACCESS BY INDEX ROWID| ENTRY_TABLE    |     1 |  8099 |     1  (0)| 00:00:01 |
|*  5 |    INDEX UNIQUE SCAN         | ACCESSION_LIST |     1 |       |     0  (0)| 00:00:01 |
Predicate Information (identified by operation id):
   3 - filter("ACCESSION_TABLE"."SYS_XDBBODY$"='P19084')
   4 - filter(SYS_CHECKACL("ACLOID","OWNERID",xmltype('<privilege
              xmlns="http://xmlns.oracle.com/xdb/acl.xsd"
              xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance"
              xsi:schemaLocation="http://xmlns.oracle.com/xdb/acl.xsd
              http://xmlns.oracle.com/xdb/acl.xsd DAV:http://xmlns.oracle.com/xdb/dav.xsd"><read-prop
              erties/><read-contents/></privilege>'))=1)
   5 - access("NESTED_TABLE_ID"="ENTRY_TABLE"."SYS_NC0001100012$")
Note
   - dynamic sampling used for this statement
SQL> quit
Disconnected from Oracle Database 10g Enterprise Edition Release 10.2.0.2.0 - Production
With the Partitioning, OLAP and Data Mining options
SQL*Plus: Release 10.2.0.2.0 - Production on Tue Feb 28 16:17:03 2006
Copyright (c) 1982, 2005, Oracle.  All Rights Reserved.
SQL> spool syncTextIndex.log
SQL> --
SQL> connect &1/&2
Connected.
SQL> --
SQL> exec ctx_ddl.sync_index('UNIPROT_FULL_TEXT')
PL/SQL procedure successfully completed.
SQL> /
SP2-0103: Nothing in SQL buffer to run.
SQL> quit
Disconnected from Oracle Database 10g Enterprise Edition Release 10.2.0.2.0 - Production
With the Partitioning, OLAP and Data Mining options
bash-2.05b$Message was edited by:
mdrake

Similar Messages

  • Oracle Text in installing Oracle 10g without licence!!

    Hi. Everyone.
    I've read some thread , but I am still confused about "oracle text".
    Now, I am testing oracle10g database.
    I downloaded 10g software from www.oracle.com, and installed it sucessfully
    on windows xp.
    When I was trying to import a dump file from oracle9i to
    the unlicenced oracle10g database, I got the error , IMP-00017, which
    is related to "Oracle Text".
    I checked "dba_users" dictionary, but ctxsys user is locked and expired.
    I read some thread on this site, and according to the advice, I tried to
    enable oracle text, using "DBCA".
    However, every database option on DBCA is disabled, I was not able to
    check oracle text.
    Lastly, how can I enable "Oracle Text" with unlicenced oracle 10g ?
    Is this possible without licence?
    I am very confused about this.
    I am looking forward to hear your experience and advices.
    Have a nice day.
    Best Regards.
    Ho.

    Well, instead of being confused, you could go to http://www.oracle.com/pls/db102/portal.portal_db?selected=1 and look at
    1) the licensing document, which would tell you whether you need a separate license, and
    2) under the 'Books' tab, look at the Text Application Developer's Guide or the Text Reference manuals for details.
    You could also look for the Oracle Text forum (from the http://forums.oracle.com page, under Database - More, or Text and ask the people who concentrate on that set of features.
    In general, Oracle Text is a set of extensions, the definitions for which are stored under user ctxsys. You would use these extensions by creating your own objects that are based on the extensions.
    For example, suppose your tables contain varchar2 columns. Create indexes that are based on ctxsys's 'context index type' and your application can then use the 'CONTAINS' keyword search capability (which is effectively a ctxsys-owned extension to the select)
    However, you would never log on to ctxsys and do anythibng with that as you risk changing the template code that Oracle has supplied.
    Message was edited by:
    Hans Forbrich
    PS: Yes, Oracle Text is included as part of the base database. Most of it is even included in the free Oracle XE database.

  • Oracle Text index hangs(Oracle 11g linux enterprise edition)

    Hi guru,
    One very criticial and showstopper issue coming in Oracle Text Indexing.
    I have table ResourceTable(ResId,Contents blob ,docformat)
    I am creating text index on Contents column by using follwing command:
    create index [IndexName] on [TableName] (contents) indextype is ctxsys.context ('lexer mylex stoplist ctxsys.default_stoplist format column ISDOCFORMAT sync(every "sysdate+1/24") storage my_text_storage memory 200M')parallel 2
    I found there is one document of text/html type which hangs oracle text indexing thread.Oracle doest not give any error message keep using CPU 100% and no progress.
    I then create test table with same stucture and put this corrupted documet record in this table.and did indexing again but its not doing index /not ignoring it and hangs .We have also tried to use timeout feature of inso filter so that if such type of document comes at the time of indexing oracle text indexing process will bypass it after specific time interval but still same issue comes and oracle is not bypassing such faulty document.
    This is realy show stopper issue and any kind of help will be greatly appricited.

    You need to raise an SR with Oracle Support for this, and send them the file which is causing the hang. It should then be easy to investigate the problem and schedule a fix.
    If you don't have a support contract, you could send the file to me and I'll raise a bug. However, if we fix it you won't be able to get the fix until it appears in the next downloadable version.
    - Roger
    roger.ford @ oracle.com

  • APEX 3.0 - Online Help Search Error on Text Index

    When I click on Help and then Find and attempt to search the online help the following error is returned
    ORA-29855: error occurred in the execution of ODCIINDEXCREATE routine ORA-20000: Oracle Text error: DRG-10700: preference does not exist: CTXSYS.DEFAULT_LEXER
    Error creating online help index.
    We are running:
    Application Express 3.0 on Oracle 10g Enterprise Edition Rel 10.2.0.3.0 - 64 bit with partitioning, OLAP and Data Mining Options
    Message was edited by:
    CFrishett

    Hi CFrishett,
    Try searching the forum for DRG-10700. It sounds like there is a problem with your Oracle Text installation.
    Regards Pete

  • Errors using DBMS_SQLTUNE Advisors for Oracle 10g

    I get errors trying to tune the below query for Oracle 10g using the DBMS_SQLTUNE advisors.
    It happens when I wrap either a large block of PL/SQL code that uses bind variables or multiple nested subqueries with multiple JOIN conditions in a SELECT query statement that I wish to tune using the 10g SQLTUNE advisors.
    Message was edited by:
    benprusinski

    Hi, I was trying to use the DBMS_SQLTUNE package to tune my sql statements used in the huge procedure. I can successfully create a task and execute it. But when I run report tuning task, I'm always getting error like the one in below example. Two questions I have now.
    1) Is this becuase I'm using bind, but not passing any values?
    2) Can I able to use to this package to tune a procedures instead of sql statement?
    Example output...
    SQL&gt; SELECT DBMS_SQLTUNE.REPORT_TUNING_TASK( 'my_sql_tuning_task3')
    2 FROM DUAL;
    DBMS_SQLTUNE.REPORT_TUNING_TASK('MY_SQL_TUNING_TASK3')
    GENERAL INFORMATION SECTION
    Tuning Task Name : my_sql_tuning_task3
    Tuning Task Owner : SCOTT
    Scope : COMPREHENSIVE
    Time Limit(seconds) : 3000
    Completion Status : COMPLETED
    Started at : 02/26/2009 21:44:41
    Completed at : 02/26/2009 21:44:41
    Number of Errors : 1
    DBMS_SQLTUNE.REPORT_TUNING_TASK('MY_SQL_TUNING_TASK3')
    Schema Name: KPRAVEEN
    SQL ID : 479831s42xj1n
    SQL Text : SELECT a.pdrorn, a.pdrcto, a.pdrlln FROM f4311 a
    WHERE a.pddoco = receiptsrcrec.prdoco AND a.pddcto = :2 AND
    a.pdkcoo = :3 AND a.pdsfxo = :4 AND a.pdlnid = :5
    ERRORS SECTION
    SQL&gt;

  • Error executing a package on Oracle 10G database

    Hi,
    I've a package on Oracle 10G database which accepts xml string as input,loads it into XMLDOM and does some processing.
    When I execute this package from .Net 2.0 client,I get the following error:
    **Error**
    err ORA-31011: XML parsing failed
    ORA-19202: Error occurred in XML processing
    LPX-00216: invalid character 0 (0x0)
    Error at line 1
    **Error**
    But when I execute the same package from .Net client 2.0 on Oracle 9i database, it seems to work fine.The xml which I am sending is well-formed one.
    Where am i going wrong?
    Please help.
    Thanks in advance...!
    Regards,
    Amit

    Check the xml strings passed as input . One of the xmls may be malformed.

  • Reg.SMTP Error while using UTL_MAIL in Oracle 10g

    Hi,
    I am getting the following SMTP error while trying to use the UTL.MAIL package of Oracle 10g. The query is as follows.
    begin
    utl_mail.send(
    sender => 'NAVEEN',
    recipients => '[email protected]',
    subject => 'Testing utl_mail',
    message => 'The receipt of this email means'|| ' that UTL_MAIL works'
    end;
    UTL_MAIL package is installesd and the port 25 is configured and firewall is changed.
    The same block was working fine before 5 days and now is giving the error as
    ORA-29279: SMTP permanent error: 501 badly formatted MAIL FROM user - no "<"
    ORA-06512: at "SYS.UTL_SMTP", line 21
    ORA-06512: at "SYS.UTL_SMTP", line 99
    ORA-06512: at "SYS.UTL_SMTP", line 222
    ORA-06512: at "SYS.UTL_MAIL", line 407
    ORA-06512: at "SYS.UTL_MAIL", line 594
    ORA-06512: at line 2
    Could you please help me out how to proceed???
    Regards,
    Naveen Kumar.

    Can you back that statement about an Oracle UTL_SMTP bug up with an actual bug number??
    From what you have posted, this is not a bug!! but expected and documented (RFC'ed) SMTP server behaviour.
    My proof:
    /home/billy> telnet mail 25
    Trying 165.143.128.26...
    Connected to mail
    Escape character is '^]'.
    220 CNTRRA20-GTW01 [CNTRRA20-GTW01] Thu, 06 Mar 2008 14:26:26 +0200
    HELO 10.251.93.58
    250 CNTRRA20-GTW01 Hello [10.251.93.58]
    MAIL FROM: naveen <[email protected]>
    501 naveen <[email protected]> : illegal character(s) in domain string
    MAIL FROM: NAVEEN
    501 NAVEEN : domain string is NULL.
    quit
    221 CNTRRA20-GTW01 closing connection. Goodbye!
    Connection closed by foreign host.
    /home/billy>
    As you can clearly see, the SMTP server expects a DOMAIN name as part of the MAIL FROM address. It also does not accept the alternative format suggested.
    Yes, not all SMTP servers are equal and some support additional formatting.
    But to imply that because the SMTP server does not accept your address formatted as string NAVEEN, it is a UTL_SMTP problem, sounds like a smelly one to me.

  • Error during the installation of ORACLE 10g for SAP MDM 5.5

    Hi all,
    I am installing ORACLE 10g on a SUSE LES 9 for a future MDM 5.5 system. While I launch the Installer I get the following error:
    Preparing to launch Oracle Universal Installer from /tmp/OraInstall2007-09-26_07-11-46AM. Please wait ...oracle@mucsapt2:/home/lrougkal/OraDb10g/database> Exception in thread "main" java.lang.UnsatisfiedLinkError: /tmp/OraInstall2007-09-26_07-11-46AM/jre/1.4.2/lib/i386/libawt.so: libXp.so.6: cannot open shared object file: No such file or directory
            at java.lang.ClassLoader$NativeLibrary.load(Native Method)
            at java.lang.ClassLoader.loadLibrary0(Unknown Source)
            at java.lang.ClassLoader.loadLibrary(Unknown Source)
            at java.lang.Runtime.loadLibrary0(Unknown Source)
            at java.lang.System.loadLibrary(Unknown Source)
            at sun.security.action.LoadLibraryAction.run(Unknown Source)
            at java.security.AccessController.doPrivileged(Native Method)
            at sun.awt.NativeLibLoader.loadLibraries(Unknown Source)
            at sun.awt.DebugHelper.<clinit>(Unknown Source)
            at java.awt.Component.<clinit>(Unknown Source)
    I have installed all the required packages from SUSE :
    binutils-2.15.90.0.1.1-32.10
    gcc-3.3.3-43.41
    gcc-c++-3.3.3-43.41
    glibc-2.3.3-98.61
    gnome-libs-1.4.1.7-671.1
    libstdc++-3.3.3-43.41
    libstdc++-devel-3.3.3-43.41
    make-3.80-184.1
    pdksh-5.2.14-780.7
    sysstat-5.0.1-35.7
    xscreensaver-4.16-2.6
    Any ideas?
    Thanks in advance,
    Loukas

    Hi Elmar,
    I have checked the packages and the XFree86-libs-4.3.99 is not installed. I guess I will have to install it.
    Now your question about oracle user. I am not sure if you have performed any SAP MDM installation with ORACLE RDBMS but the installation guide is totally different than the normal SAP inst guides. Indeed someone needs to install separately SAP MDM and ORACLE and in my installation I do not install NetWeaver since it is not mandatory for the testing phase of the project. You can have a look at the guide (it is very poor -no reference to ORACLE details):
    https://websmp105.sap-ag.de/~sapidb/011000358700000271882007E
    So the official ORACLE inst gudie says to install the ORACLE software with the oracle user.
    Rgds,
    Louka

  • Errors in manual creation of oracle 10g database

    I created oracle 10g database manually and i am getting post installation errors.. could you please help out?
    I executed @?/sqlplus/admin/pupbld.sql but it still shows
    Error accessing PRODUCT_USER_PROFILE
    Warning: Product user profile information not loaded!
    You may need to run PUPBLD.SQL as SYSTEM
    i tried to see
    SQL> desc product_user_profile;
    ERROR:
    ORA-04043: object "SYSTEM"."SQLPLUS_PRODUCT_PROFILE" does not exist
    not there?? any other scripts to be run ? please guide me.
    2. I can not able login sys@sid as sysdba
    SQL> select * from v$pwfile_users;
    no rows selected
    i changed
    remote_login_passwordfile string EXCLUSIVE
    re-started db but no help...
    SQL> grant sysdba to sys;
    grant sysdba to sys
    ERROR at line 1:
    ORA-01990: error opening password file
    I re-created
    $ORACLE_HOME/bin/orapwd file=$ORACLE_HOME/dbs/orapwmydb.ora password=xxxx entries=5 force=y
    but no help..
    Could one please help out... ! great thanks in advance..

    thanks for prompt reply .. but still one issue remain..
    oracle DEVS $ sqlplus sys@sid sysdba
    SQL*Plus: Release 10.1.0.4.0 - Production on Thu Jan 7 10:51:44 2010
    Copyright (c) 1982, 2005, Oracle. All rights reserved.
    Enter password:
    ERROR:
    ORA-01031: insufficient privileges
    but i can able to login as sqlplus sys as sysdba
    SQL> select * From v$pwfile_users;
    no rows selected
    i tired to do
    SQL> grant sysdba to sys;
    grant sysdba to sys
    ERROR at line 1:
    ORA-01990: error opening password file
    '/u02/app/oracle/product/10.1.0/dbs/orapw'
    ORA-27037: unable to obtain file status
    Linux Error: 2: No such file or directory
    Additional information: 3
    there is already one password file with orapwsid.ora.. how this should be solved ? please help. thanks

  • Errors in impdp command on oracle 10g database

    Hi,
    could you plz help me to solve below errors which are coming while doing import with impdp command in oracle 10g 10.1.0.4.0 os: Red Hat Enterprise Linux ES release 4
    ORA-06502: PL/SQL: numeric or value error: character string buffer too small
    ORA-06502: PL/SQL: numeric or value error: character string buffer too small
    Job "DCA"."SYS_IMPORT_SCHEMA_01" stopped due to fatal error at 15:31
    i tried to restart job but the following errors coming
    UDI-00008: operation generated ORACLE error 39078
    ORA-39078: unable to dequeue message for agent KUPC$A_1_20081111155728 from queue "KUPC$C_1_20081111155728"
    ORA-06512: at "SYS.DBMS_DATAPUMP", line 2356
    ORA-06512: at "SYS.DBMS_DATAPUMP", line 3261
    ORA-06512: at line 1
    thanks in advance

    NAME TYPE VALUE
    streams_pool_size big integer 0
    sga_target big integer 200M
    what could be the value for avoiding errors! thanks in advance

  • Errors in impdp command on oracle 10g database-urget help needed

    Hi,
    could you plz help me to solve below errors which are coming while doing import with impdp command in oracle 10g 10.1.0.4.0 os: Red Hat Enterprise Linux ES release 4
    ORA-06502: PL/SQL: numeric or value error: character string buffer too small
    ORA-06502: PL/SQL: numeric or value error: character string buffer too small
    Job "DCA"."SYS_IMPORT_SCHEMA_01" stopped due to fatal error at 15:31
    i tried to restart job but the following errors coming
    UDI-00008: operation generated ORACLE error 39078
    ORA-39078: unable to dequeue message for agent KUPC$A_1_20081111155728 from queue "KUPC$C_1_20081111155728"
    ORA-06512: at "SYS.DBMS_DATAPUMP", line 2356
    ORA-06512: at "SYS.DBMS_DATAPUMP", line 3261
    ORA-06512: at line 1
    thanks in advance

    Can you check Metalink Note 376022.1? Your STREAMS_POOL_SIZE parameter may be too small.
    If you don't have Metalink access, try this :
    sql> alter system set STREAMS_POOL_SIZE=100M scope=spfile;
    sql> shutdown immediate
    sql> startup
    Note : the Portal Applications forum may not be the appropriate forum for this datapump issue. Try one of the database forums as you'll have a wider audience there.

  • ORA-29279: SMTP permanent error: To Send Mail from Oracle 10g (10.2.0.1)

    I have installed Oracle 10g (10.2.0.1) on Windows XP (SP2) machine at my home PC.There is a broadband connection on my home PC.I have installed UTL_MAIL package and then set SMTP_OUT_PARAMETER by the following SQL Statement.
    My machine IP address is 192.168.0.3
    SQl> alter system set smtp_out_server = 'smtp.bsnl.in:25' scope = 25;
    Then we run the following script.
    BEGIN
    UTL_MAIL.SEND(
    SENDER => '[email protected]',
    RECIPIENTS => '[email protected]',
    SUBJECT => 'Testing UTL_MAIL',
    MESSAGE => 'The receipt of this email means'||
    'that it works for UTL_MAIL'
    END;
    Then following error message comes.
    BEGIN
    ERROR at line 1:
    ORA-29279: SMTP permanent error: 553 Authentication is required to send mail as
    <[email protected]>
    ORA-06512: at "SYS.UTL_SMTP", line 21
    ORA-06512: at "SYS.UTL_SMTP", line 99
    ORA-06512: at "SYS.UTL_SMTP", line 222
    ORA-06512: at "SYS.UTL_MAIL", line 407
    ORA-06512: at "SYS.UTL_MAIL", line 594
    ORA-06512: at line 2
    Can anybody suggest the solution of the above problem.

    Hi,
    is your smtp server configured to use anonymous connection?
    Attackwave
    Reply Code       Description
    211      System status, or system help reply
    214      Help message [Information on how to use the receiver or the meaning of a particular non-standard command; this reply is useful only to the human user]
    220      <domain> Service ready
    221      <domain> Service closing transmission channel
    250      Requested mail action okay, completed
    251      User not local; will forward to <forward-path>
    252      OK, pending messages for node <node> started. Cannot VRFY user (for example, info is not local), but will take message for this user and attempt delivery.
    253      OK, <messages> pending messages for node <node> started
    354      Start mail input; end with <CRLF>.<CRLF>
    355      Octet-offset is the transaction offset
    421      <domain> Service not available, closing transmission channel (This may be a reply to any command if the service knows it must shut down.)
    450      Requested mail action not taken: mailbox unavailable [for example, mailbox busy]
    451      Requested action terminated: local error in processing
    452      Requested action not taken: insufficient system storage
    453      You have no mail.
    454      TLS not available due to temporary reason. Encryption required for requested authentication mechanism.
    458      Unable to queue messages for node <node>
    459      Node <node> not allowed: reason
    500      Syntax error, command unrecognized (This may include errors such as command line too long.)
    501      Syntax error in parameters or arguments
    502      Command not implemented
    503      Bad sequence of commands
    504      Command parameter not implemented
    521      <Machine> does not accept mail.
    530      Must issue a STARTTLS command first. Encryption required for requested authentication.
    534      Authentication mechanism is too weak.
    538      Encryption required for requested authentication mechanism.
    550      Requested action not taken: mailbox unavailable [for , mailbox not found, no access]
    551      User not local; please try <forward-path>
    552      Requested mail action terminated: exceeded storage allocation
    *553      Requested action not taken: mailbox name not allowed [for example, mailbox syntax incorrect]*
    554      Transaction failed

  • Error in Drop Table in Oracle 10G

    Hi All,
    When I try to drop any of the table in one of the oracle 10G database schema
    I am getting the following error.
    As for I know this error will come in PL/SQL cursor block if the exact fetch returns more than one row.
    Can any one explained the reason for this...
    Error on line 0
    DROP TABLE "TMP_GL_DATA2"
    ORA-00604: error occurred at recursive SQL level 1
    ORA-01422: exact fetch returns more than requested number of rows
    Thanks in advance..
    Regards
    Karthik...

    Fix the error in your DDL trigger.

  • Oracle error ORA-00600 when using Oracle 10g and Sun One Web Server 6.1

    I have a java application that was running under Solaris 8 and Oracle 9i. I am trying to get it up and running on a new server that is configured with Solaris 9 and Oracle 10g. Whenever the application tries to connect to the database it receives the following error: ORA-00600 [ttcgcshnd-1][0]. My research indicates that this is an internal Oracle error that represents a low level unexpected condition. I have looked through my configuration for the Web Server and I have not been able to determine the cause of this problem. My DBA tells me that we have the latest patch installed for Oracle! Has anyone encountered this problem before? Any help would be greatly appreciated!

    If the problem is also present in a SWING app, i.e. outside the web server, then it is porbably something external to the webserver.
    I think you should ensure that the driver and database are compatible with each other. It is very likely that you need a new jdbc driver for the new database.
    download from here http://www.oracle.com/technology/software/tech/java/sqlj_jdbc/htdocs/jdbc101020.html
    try the ojdbc14.jar

  • Query Regarding Rich Text Editor in Oracle 10G

    Hello.
    Can anyone let me know is their any privilege in Oracle 10g that we Incorporate the Rich Text Editor functionality. Currently we are working on Laboratory / Radiology Template based Reports in which they are requesting their should be option through which we can simply Cut and Paste our organized TEXT(REPORT) which are formatted in MS WORD with Bold,Underline and in Bullets format, it should simply paste in Editor and we can view a Template based report with formatted REPORT.
    We are using Oracle 10G and it's Applet based Application. Any clue how can we Accomplish this? Any Suitable Suggestion?
    Thanks

    Sorry, I referred this already.. This also returns the HTML text. But i don't want the HTML text. I want Normal Text what i enter in the Editor. But as of now all the editors are returning HTML text. So in the front end also it is showing HTML text only.
    I entered the text in Editor as
    System Defaulted Note
    Quote entered
    But editor returns as below and the same way it is showing in the Front end application instead of above text.
    <html>
    <head>
    </head>
    <body>
    System Defaulted Note
    <p>
    Quote entered
    </p>
    </body>
    </html>

Maybe you are looking for