String.matches vs Pattern and Matcher object

Hi,
I was trying to match some regex using String.matches but for me it is not working (probably I am not using it the way it should be used).
Here is a simple example:
/* This does not work */
String patternStr = "a";
String inputStr = "abc";
if(inputStr.matches( "a" ))
System.out.println("String matched");
/* This works */
Pattern p = Pattern.compile( "a" );
Matcher m = p.matcher( "abc" );
boolean found = false;
while(m.find())
System.out.println("Matched using Pattern and Matcher");
found = true;
if(!found)
System.out.println("Not matching with Pattern and Matcher");
Am I not matches method of String class properly?
Please throw some lights on this.
Thank you.

String.matches looks at the whole string.
bsh % "abc".matches("a");
<false>
bsh % "abc".matches("a.*");
<true>

Similar Messages

  • Design Pattern and ABAP Objects

    Hello Friends,
    I would like to know, if ABAP Objects can be used to do pattern oriented programming ?
    For example GANG of four has provided almost more then 30 design pattern ( MVC, singelton, Obserable, FACADE,,,etc) can we implement patterns using ABAP ??
    Many thanks
    Haider Syed

    Hi,
    Take a look at the following site:
    http://patternshare.org/
    It has all the basic patterns from the GOF and a lot more. I can recommend the ones from Martin Fowler but be sure you start with the ones from the GOF.
    All patterns are described by using UML so it's very easy to translate them into ABAP OO code.
    Regarding your other question. For the observer pattern I used an interface which the SAP had already created if_cm_observer and created my own abstract observable class. The observable class is nearly a 100% copy of the java.util. one
    regards
    Thomas

  • How to use regular expression using pattern and match concept for this scenario?

    Hi Guys,
    I have a string "We have 7 tutorials for Java, 2 tutorials for Javascript and 1 tutorial for Oracle"
    I need to replace the numbers based on the below condition.
    if more then 5, replace with many
    if less then 5, replace with a few
    if it is 1, replace with "only one"
    below is my code, I am missing the equating part to replace the numbers could any one of you please help me out fixing this.
    private static String REGEX="(\\d+)";
      private static String INPUT="We have 7 tutorials for Java, 2 tutorials for Javascript and 1 tutorial for Oracle";
      //String pattern= "(.*)(\\d+)(.*)";
      private static String REPLACE = "replace with many";
      public static void main(String[] args) {
      // Create a Pattern object
           Pattern r = Pattern.compile(REGEX);
        // Now create matcher object.
           Matcher m = r.matcher(INPUT);
           //replace the value 7 by the replace string
    //How to equate the (\\d+)  greater than a number  and use it the below code.
                  INPUT = m.replaceAll(REPLACE);
           //Print the final Result;
            System.out.println(INPUT);
    Thanks and Regards,

    Hi,
    Try the following which makes use of  "appendReplacement" instead with the "start" and "end" methods to locate and check the searched "regExp" string before dynamically setting the "replace" string:
    String regExp = "\\d+";
    String input = "We have 7 tutorials for Java, 2 tutorials for Javascript and 1 tutorial for Oracle";
    String replace;
    Pattern p = Pattern.compile(regExp);
    // get a matcher object
    Matcher m = p.matcher(input);
    StringBuffer sb = new StringBuffer();
    while (m.find()) {
       Integer x = Integer.valueOf(input.substring(m.start(), m.end()));
       replace = (x >= 5) ? "many" : (x == 1) ? "only one" : "few";
       m.appendReplacement(sb, replace);
    m.appendTail(sb);
    System.out.println(sb.toString());
    HTH.
    Regards,
    Rajen
    P.S: Please mark the post as answered/helpful if it resolves your issue for the benefit of all community members.

  • Pattern and Matcher of Regular Expressions

    Hello All,
    MTMISRVLGLIRDQAISTTFGANAVTDAFWVAFRIPNFLRRLFAEGSFATAFVPVFTEVK
    ETRPHADLRELMARVSGTLGGMLLLITALGLIFTPQLAAVFSDGAATNPEKYGLLVDLLR
    LTFPFLLFVSLTALAGGALNSFQRFAIPALTPVILNLCMIAGALWLAPRLEVPILALGWA
    VLVAGALQLLFQLPALKGIDLLTLPRWGWNHPDVRKVLTLMIPTLFGSSIAQINLMLDTV
    IAARLADGSQSWLSLADRFLELPLGVFGVALGTVILPALARHHVKTDRSAFSGALDWGFR
    TTLLIAMPAMLGLLLLAEPLVATLFQYRQFTAFDTRMTAMSVYGLSFGLPAYAMLKVLLP
    I need some help with the regular expressions in java.
    I have encountered a problem on how to retrieve two strings with Pattern and Matcher.
    I have written this code to match one substring"MTMISRVLGLIRDQ", but I want to match multiple substrings in a string.
    Pattern findstring = Pattern.compile("MTMISRVLGLIRDQ");
    Matcher m = findstring.matcher(S);
    while (m.find())
    outputStream.println("Selected Sequence \"" + m.group() +
    "\" starting at index " + m.start() +
    " and ending at index " m.end() ".");
    Any help would be appreciated.

    Double post: http://forum.java.sun.com/thread.jspa?threadID=726158&tstart=0

  • The java and sql object type  was not matched

    My table(Oracle10.2) has a varying arrays column. For mapping to java classes, I use JDeveloper(10.1.3.1.0) to generate java classes. Then I try to insert a record into this varrying arrays column with java. While it always complaints java.sql.SQLException.the java and sql object type was not matched. I can not find the reason.
    My java code:
                   StructDescriptor structdesc = StructDescriptor.createDescriptor(
                             "VARRAY_SEQ", con);
                   int nid=20;
                   int pid=546;
                   BigDecimal mynid=new BigDecimal(nid);
                   mynid=mynid.setScale(0, BigDecimal.ROUND_HALF_UP);
                   BigDecimal mypid=new BigDecimal(pid);
                   mypid=mypid.setScale(0, BigDecimal.ROUND_HALF_UP);
                   Object[] attributes = { "ASDF", mynid, "Developer", mypid,
                             "rwretw" };
                   STRUCT Rel = new STRUCT(structdesc, con, attributes);
                   stmt.setObject(8, Rel);
                   stmt.execute();
                   stmt.close();
    And the STRUCT is
    public RelSeq(String nucl, java.math.BigDecimal neId, String nuor, java.math.BigDecimal pId, String phor) throws SQLException
    { _init_struct(true);
    setNucl(nucl);
    setNeId(neId);
    setNuor(nuor);
    setPId(pId);
    setPhor(phor);
    }

    My table(Oracle10.2) has a varying arrays column. For mapping to java classes, I use JDeveloper(10.1.3.1.0) to generate java classes. Then I try to insert a record into this varrying arrays column with java. While it always complaints java.sql.SQLException.the java and sql object type was not matched. I can not find the reason.
    My java code:
                   StructDescriptor structdesc = StructDescriptor.createDescriptor(
                             "VARRAY_SEQ", con);
                   int nid=20;
                   int pid=546;
                   BigDecimal mynid=new BigDecimal(nid);
                   mynid=mynid.setScale(0, BigDecimal.ROUND_HALF_UP);
                   BigDecimal mypid=new BigDecimal(pid);
                   mypid=mypid.setScale(0, BigDecimal.ROUND_HALF_UP);
                   Object[] attributes = { "ASDF", mynid, "Developer", mypid,
                             "rwretw" };
                   STRUCT Rel = new STRUCT(structdesc, con, attributes);
                   stmt.setObject(8, Rel);
                   stmt.execute();
                   stmt.close();
    And the STRUCT is
    public RelSeq(String nucl, java.math.BigDecimal neId, String nuor, java.math.BigDecimal pId, String phor) throws SQLException
    { _init_struct(true);
    setNucl(nucl);
    setNeId(neId);
    setNuor(nuor);
    setPId(pId);
    setPhor(phor);
    }

  • Pattern and Matching question

    Hey,
    I'm trying to use the pattern and matcher to replace all instances of a website
    address in some html documents as I process them and post them. I'm
    including a sample of some of the HTML below and the code I"m using to
    process it. For some reason it doesn't replace the sites in the underlying
    images and i can't figure out what I'm doing wrong. Please forgive all the
    unused variables, those are relics of another way i may have to do this if i
    can't get the pattern thing to work.
    Josh
         public static void setParameters(File fileName)
              FileReader theReader = null;
              try
                   System.out.println("beginning setparameters guide2)");
                   File fileForProcessing=new File(fileName.getAbsolutePath());
                   //wrap the file in a filereader and buffered reader for maximum processing
                   theReader=new FileReader(fileForProcessing);
                   BufferedReader bufferedReader=new BufferedReader(theReader);
                   //fill in data into the tempquestion variable to be populated
                   //Set the question and answer texts back to default
                   questionText="";
                   answerText="";
                   //Define the question variable as a Stringbuffer so new data can be appended to it
                   StringBuffer endQuestion=new StringBuffer();//Stringbuffer to store all the lines
                   String tempQuestion="";
                   //Define new file with the absolutepath and the filename for use in parsing out question/answer data
                   tempQuestion=bufferedReader.readLine();//reads the nextline of the question
                   String tempAlteredQuestion="";//for temporary alteration of the nextline
                   //while there are more lines append the stringbuffer with the new data to complete the question buffer
                   StringTokenizer tokenizer=new StringTokenizer(tempQuestion, " ");//tokenizer for reading individual words
                   StringBuffer temporaryLine; //reinstantiate temporary line holder each iterration
                   String newToken;   //newToken gets the very next token every iterration?  changed to tokenizer moretokens loop
                   String newTokenTemp;   //reset newTokenTemp to null each iterration
                   String theEndOfIt;  //string to hold everything after .com
                   char[] characters;  //character array to hold the characters that are used to hold the entire link
                   char lastCharChecked;
                   Pattern thePattern=Pattern.compile("src=\"https:////fakesite.com//ics", Pattern.LITERAL);
                   Matcher theMatcher=thePattern.matcher(tempQuestion);
                        while(tempQuestion!=null) //every time the tempquestion reads a newline, make sure you aren't at the end
                             String theReplacedString=theMatcher.replaceAll("https:////fakesite.com//UserGuide/");     
                             //          temporaryLine=new StringBuffer();
                             //add the temporary line after processed back into the end question.
                             endQuestion.append(theReplacedString);                              //temporaryLine.toString());
                             //reset the tempquestion to the newline that is going to be read
                             tempQuestion=bufferedReader.readLine();
                             if(tempQuestion!=null)
                                  theMatcher.reset(tempQuestion);
                             /*newTokenTemp=null;
                             while(tokenizer.hasMoreTokens())
                                  newToken=tokenizer.nextToken(); //get the next token from the line for processing
                                  System.out.println("uhhhhhh");
                                  if(newToken.length()>36)  //if the token is long enough chop it off to compare
                                       newTokenTemp=newToken.substring(0, 36);
                                  if(newTokenTemp.equals("src=\"https://fakesite.com"));//compare against the known image source
                                       theEndOfIt=new String();  //intialize theEndOfIt
                                       characters=new char[newToken.length()];  //set the arraylength to the length of the initial token
                                       characters=newToken.toCharArray();  //point the character array to the actual characters for newToken
                                       lastCharChecked='a';  // the last character that was compared
                                       int x=0; //setup the iterration variable and go from the length of the whole token back till you find the first /
                                       for(x=newToken.length()-1;x>0&&lastCharChecked!='/';x--)
                                            System.out.println(newToken);
                                            //set last char checked to the lsat iterration run
                                            lastCharChecked=characters[x];
                                            //set the end of it to the last char checked and the rest of the chars checked combined
                                            theEndOfIt=Character.toString(lastCharChecked)+theEndOfIt;
                                       //reset the initial newToken value to the cut temporary newToken root + userguide addin, + the end
                                       newToken=newTokenTemp+"//Userguide"+theEndOfIt;
                                  //add in the space aftr the token to the temporary line and the new token, this is where it should be parsed back together
                                  temporaryLine.append(newToken+" ");
                             //add the temporary line after processed back into the end question.
                             endQuestion.append(temporaryLine.toString());
                             //reset the tempquestion to the newline that is going to be read
                             tempQuestion=bufferedReader.readLine();
                             //reset tokenizer to the new temporary question
                             if(tempQuestion!=null)
                             tokenizer=new StringTokenizer(tempQuestion);
                   //Set the answer to the stringbuffer after converting to string
                   answerText=endQuestion.toString();
                   //code to take the filename and replace _ with a space and put that in the question text
                   char theSpace=' ';
                   char theUnderline='_';
                   questionText=(fileName.getName()).replace(theUnderline, theSpace);
              catch(FileNotFoundException exception)
                   if(logger.isLoggable(Level.WARNING))
                   logger.log(Level.WARNING,"The File was Not Found\n"+exception.getMessage()+"\n"+exception.getStackTrace(),exception);
              catch(IOException exception)
                   if(logger.isLoggable(Level.SEVERE))
                   logger.log(Level.SEVERE,exception.getMessage()+"\n"+exception.getStackTrace(),exception);
              finally
                   try
                        if(theReader!=null)
                             theReader.close();
                   catch(Exception e)
    <SCRIPT language=JavaScript1.2 type=text/javascript><!-- if( typeof( kadovInitEffects ) != 'function' ) kadovInitEffects = new Function();if( typeof( kadovInitTrigger ) != 'function' ) kadovInitTrigger = new Function();if( typeof( kadovFilePopupInit ) != 'function' ) kadovFilePopupInit = new Function();if( typeof( kadovTextPopupInit ) != 'function' ) kadovTextPopupInit = new Function(); //--></SCRIPT>
    <H1><IMG class=img_whs1 height=63 src="https://fakesite.com/ics/header4.jpg" width=816 border=0 x-maintain-ratio="TRUE"></H1>
    <H1>Associate Existing Customers</H1>
    <P>blahalbalhblabhlab blabhalha blabahbablablabhlablhalhab.<SPAN style="FONT-WEIGHT: bold"><B><IMG class=img_whs2 height=18 alt="Submit a

    If you use just / it misinterprets it and it ruins
    your " " tags for a string. I don't think so. '/' is not a special character for Java regex, nor for Java String.
    The reason i used
    literal is to try to force it to directly match,
    originally i thought that was the reason it wasn't
    working.That will be no problem because it enforces '.' to be treated as a dot, not as a regex 'any character'.
    Message was edited by:
    hiwa

  • Patterns and Matcher issue....

                            String ss = m.group();
                            if(linkPatter.matcher(ss).matches()){
                                    System.out.println(linkPatter.matcher(ss).group());
                            }Is throwing:
    Exception in thread "main" java.lang.IllegalStateException: No match found
         at java.util.regex.Matcher.group(Matcher.java:485)
         at java.util.regex.Matcher.group(Matcher.java:445)
         at WorldParser.main(WorldParser.java:30)No clue.

    In case you didn't realize it, the problem is that you created two Matcher object.
    On the first you called matches() and on the second one you called group(). You must only call group() after matches() (or find()) was called. Since you never called that on the second object, your code fails.
    The solution is to only create one Matcher (which is probably what you did).

  • Patterns and Matcher.find()

    I would be really grateful for some assistance on this. I have been at this for three hours and can't get it correct.
    I have a string such as this: "Hello this is a great <!-- @@[IMAGINE_SPACIAL_VECTOR]@@ --> little string"
    I want to use RegEx, Pattern and Matcher.find() to extract "IMAGINE_SPACIAL_VECTOR" ie. the text between "<!-- @@[" and "]@@ -->"
    Thanks in advance for your help

    import java.util.regex.Matcher;
    import java.util.regex.Pattern;
    public class Example {
         public static void main(String[] args) {
              String data = "Hello this is a great <!-- @@[IMAGINE_SPACIAL_VECTOR]@@ --> little string";
              Matcher matcher = Pattern.compile("<!-- @@\\[(.*?)]@@ -->").matcher(data);
              while (matcher.find()) {
                   System.out.println(matcher.group(1));
    }Might not be the best way, but it works.
    Kaj

  • How to Use Pattern and Matcher class.

    HI Guys,
    I am just trying to use Pattern and Matcher classes for my requirement.
    My requirement is :- It should allow the numbers from 1-7 followed by a comma(,) again followed by the numbers from
    1-7. For example:- 1,2,3,4,5 or 3,6,1 or 7,1,3 something like that.
    But it should not allow 0,8 and 9. And also it should not allow any Alphabets and special characters except comma(,).
    I have written some thing like..
    Pattern p = Pattern.compile("([1-7])+([\\,])?([1-7])?");
    Is there any problem with this pattern ??
    Please help out..
    I am new to pattern matching concept..
    Thanks and regards
    Sudheer

    ok guys, this is how my code looks like..
    class  PatternTest
         public static void main(String[] args)
              System.out.println("Hello World!");
              String input = args[0];
              Pattern p = Pattern.compile("([1-7]{1},?)+");
              Matcher m = p.matcher(input);
              if(m.find()) {
                   System.out.println("Pattern Found");
              } else {
                   System.out.println("Invalid pattern");
    }if I enter 8,1,3 its accepting and saying Pattern Found..
    Please correct me if I am wrong.
    Actually this is the test code I am presenting here.. I original requirement is..I will be uploading an excel sheets containg 10 columns and n rows.
    In one of my column, I need to test whether the data in that column is between 1-7 or not..If I get a value consisting of numbers other than 1-7..Then I should
    display him the msg..
    Thanks and regards
    Sudheer

  • Regular expressions, using pattern and matcher but not include the pattern

    Hi all
    i have a regular expression but in my matcher it is including the text that is in my regular expression.
    ie
    String str="-------------------stuff===========";
    Pattern mainBody = Pattern.compile("-----(.*?)=====", Pattern.MULTILINE);this matches -------------------stuff=====
    now i expect to get some - in there as i match from the start, but i dont want to have the = in the match. how do i do a match that excludes the matching expressions.

    nevermind, figured it out
    when i do myMatch.group(1) it gives me just my match
    sorry for wasting time :)

  • Searching and Matching - Difference between 'Match Pattern' and 'Match Geometric Pattern'?

    I was wondering if someone can explain to me the difference between  'Match Pattern' and 'Match Geometric Pattern' VIs? I'm really not sure which best to use for my application. I'm trying to search/match small spherical particles in a grey video in order to track their speed (I'm doing this after subtracting two subsequent frames to get rid of background motion artifacts).
    Which should I use?
    Thank you!
    Solved!
    Go to Solution.

    Hi TKassis,
    1.You may find from this link for the difference between these two,
    Pattern Match : http://zone.ni.com/reference/en-XX/help/370281P-01/imaqvision/imaq_match_pattern_3/
    Geometric Match : http://zone.ni.com/reference/en-XX/help/370281P-01/imaqvision/imaq_match_geometric_pattern/.
    2. I always prefer match pattern because of its execution speed, and incase of geometric pattern match it took lot of time to match your result. You may find in the attached figure for same image with these two algorithm execution time.
    Sasi.
    Certified LabVIEW Associate Developer
    If you can DREAM it, You can DO it - Walt Disney

  • String.matches() faulty?

    I wondered why my regExp didn't work when I called it with
    myString.matches(searchString);So I wrote this test code:
            System.out.println("Test: if substring exists:");
            String text = "Using org.apache.xerces.jaxp.SAXParserImpl$JAXPSAXParser as SAX2 Parser";
            String search = "as SAX2 Parser";
            String regExp = "\\S*("+search.toUpperCase()+"\\S*)";
            Pattern pat = Pattern.compile(regExp);
            Matcher m = pat.matcher(text.toUpperCase());
            while (m.find()) {
                System.out.println("found2: "+text.substring(m.start(), m.end()));
            System.out.println("Same with String.matches:");
            System.out.println("found2: "+text.matches(regExp));and the first custom code matches the regExp and the String.matches() doesn't match. What's the catch?

    "abc" -> find ("b") -> finds "b"
    "abc".matches("b") -> returns false
    "b".matches("b") -> returns false
    "abc".matches(".b.") > returns trueIf you'd like you could say that matches assumes an
    implicit "^" at the beginning and an "$" at the end
    of your regex. It tries to match the entire
    string and if it doesn't capture it all it returns
    false.Why is
    "b".matches("b") -> returns false?

  • String.matches() question - regular expression help

    How come the following code's if condition returns false?
    String someFile="Dr. Phil.pdf";
    if (someFile.matches("[.][Pp][Dd][Ff]$")) {
      System.out.println("File is a pdf file.");
    }When I change the the matches method to matches(".*[Pp][Dd][Ff]$") it works, so does that mean it has to match the entire string to return true? If so, how can I determine if a partial match occured?
    If partial matching isn't feasible, then can someone help me look determine if this is the best matching pattern to use:
    matches(".*[.][Pp][Dd][Ff]$")Thanks.

    The documentation is your friend.
    [String.matches(regex)|http://java.sun.com/javase/6/docs/api/java/lang/String.html#matches(java.lang.String)] says:
    An invocation of this method of the form str.matches(regex) yields exactly the same result as the expression
    Pattern.matches(regex, str)And [Pattern.matches(regex, str)|http://java.sun.com/javase/6/docs/api/java/util/regex/Pattern.html#matches(java.lang.String, java.lang.CharSequence)] says
    behaves in exactly the same way as the expression
    Pattern.compile(regex).matcher(input).matches()And [Matcher.matches()|http://java.sun.com/javase/6/docs/api/java/util/regex/Matcher.html#matches()] says
    Attempts to match the entire region against the pattern.

  • How can I search for an exact string match in my emails?

    I was looking for an old email that I had about Re-Animator The Musical. So, in the search bar in the upper right corner of the Thunderbird window, I typed "re-animator". I got 59 hits, and the message that actually contained the string "re-animator" was 27th, when sorted by relevance. All of the other hits were emails which contained the word "animal" or "animals", which to me has nothing to do with "re-animator". I'm surprised that those were considered hits at all, much less that they were considered more relevant than the one message which actually contained the desired string.
    I actually tried three different searches:
    reanimator
    re-animator
    "re-animator"
    (i. e. the first two were without quotes and the third was with quotes). All three of these variations had the same problem, though, that messages containing "animal" were ranked before the message containing "re-animator".
    The desired message contained the word "Re-Animator" (with that capitalization and hyphenation), and also contained "reanimatorthemusical" as part of a URL that was mentioned in the message. So, I would have expected both the search with the hyphen and the search without the hyphen to have been good hits for this message.
    My question is: How can I tell Thunderbird to search for messages that literally contain the string I ask for, and not get "creative" with the matches, as it seems to be doing for some reason?
    (I'm using Thunderbird 31.3.0 on Mac OS X 10.9.5.)

    No, searching for:
    "Animator" musical
    still has the exact same problem: it still wants to find "animal" instead of "animator". Why?
    Yes, I had already read the support article you linked to, but I hadn't found anything in it about why Thunderbird would prefer "animal" over "animator", or how to disable this misfeature. Is there no better documentation for the search bar than that?
    (And the search for "Animator The Musical" didn't find my message, simply because my message didn't contain that exact string. It contained "I am on a waiting list for some musical tickets for Sunday, but I haven't heard back yet. It is a preview of The Re-Animator. ( http://www.reanimatorthemusical.com/ )." The search for "Animator The Musical" only had a single hit, your message in which you suggest searching for that.)

  • The case structure is not working well on comaring two strings using true or false string matching VI

    I need an execution of commands after the reply from the instrument matches with the string I provided for that i used true or false string match VI on which the true string the matching command and the string is the reply from the instrument. And I put the further executionable commands in frame after frame of sequence loop in the true of the case structure. Amd finally I given all the output strings to the concatenate string to get all the replies as one loop. But when I execute the program the desired result is not available. So kindly please help me to overcome this problem.  
    Attachments:
    basic serial with changes.vi ‏24 KB

    You VI makes absolutely no sense and I would recommend you start with a few simple LabVIEW tutorials before trying to tackle this.
    What is the point of the FOR loop with 1 iteration, it might as well not even be there, same difference.
    Why is there an abort primitive in the FOR loop, this mean the program will unconditionally stop abort before any downstream code will ever go into action. The program will never get past the FOR loop.
    You created a circular data dependency and LabVIEW inserted a feedback node automatically, making things even worse. (see also)
    You need to learn about dataflow, execution order, and data dependency.
    You need to learn about the various types of tunnels (plain, autoindexing, etc.)
    There is a tremendous amount of duplicate code. Large code sections are the same, differeing only by a string. You should only have one copy of that code inside a proper state machine. Have a look at the design templates and examples that ship with LabVIEW.
    LabVIEW Champion . Do more with less code and in less time .

Maybe you are looking for