Update on Bioinformatics WIKI, scripting challenges, and a general question
I am waiting for my site to go on-line at Oak Ridge National Labs (USA, Tennessee). Should be another week or so, maybe less.
When that happens, you will see a veritable explosion of scripting challenges in my wiki (Emerging Technologies->Bioinformatics.)
One general question in preparation for these challenges.
There are a number of standard bioinformatic programs that can be run interactively via the web at various sites, e.g. "BLAST" and "STRIDE".
Although these can also be run locally, this requires that you download large databases and keep them updated.
So here's my question to the scripting experts:
Are scripting languages powerful enough to submit queries to web pages and then use regex's to parse the html that is returned?
Bill Mann has used PERL to do some of the required regex parsing, but there is a lot left to do, and, his stuff only works when a perl program is invoking a bioinformatic program locally, not interactively.
If so, we all can do some beautiful stuff together , if anyone is interested ...
...my wiki on...
There is by it's very nature no such thing as MY WIKI, except you run your own wiki project in an exclusive mode. Which were...well ... unusual.
Are scripting languages powerful enough to submit queries to web pages and then use regex's to parse the html that is returned?
Yes.
anton
Similar Messages
-
Report Builder Question - OA AR Aging - and a general question
I'm sure this is the wrong forum for this question, but I thought there might be someone here who might be using Oracle Applications and Report Builder who'd be kind enough to help me out.
We've recently implemented Oracle Applications 11.5.10 and I have to use report builder to change the Accounts Receiveable Aging (7 bucket) to a 5 bucket report. I've already made some changes to the seeded "ARXAGMW.rdf" report, but I'm not a big Oracle Reports guy. I've stumbled through making some changes in various other reports. But this one is just plain nasty! :)
I was thinking that I could simply add buckets 6 & 7 to bucket 5, then just hide or delete the 6 & 7 buckets. But I'm not sure where to even start. Any help with this would GUARANTEE a Christmas or other holiday card this year! :)
I really want to keep this simple as possible, so any help would be very....helpful. :)
Oh, my general question is: Are there any resouces/books for Oracle Reports (Report Builder)? I feel so lost trying to modify existing reports, let alone creating new ones.
Thanks again!
SteveHi Steve,
I am working on the 7-bucket aging report and i want to add a new field in data model.
As the query is build dynamically, i have modified the function BUILD_CUSTOMER_SELECT to meet my requirements.
But the problem is that in the data model, the field is not present in my Grouping. and if I try to add the field in the Data Model query (Q_ Customer) section,
i get the following error: ORA-01789: query block has incorrect number of result columns.
The query is as shown below:
select rpad('a',50,'-') short_cust_name,
0 cust_id,
rpad('a',30,'-') cust_no,
rpad('a',500,'-') sort_field1,
rpad('a',40,'-') sort_field2,
0 payment_sched_id,
rpad('a',32,'-') class,
sysdate due_date,
0 amt_due_remaining,
0 days_past_due ,
0 amount_adjusted,
0 amount_applied,
0 amount_credited,
sysdate gl_date,
'x' data_converted,
0 ps_exchange_rate,
0 b0,
0 b1,
0 b2,
0 b3,
0 b4,
0 b5,
0 b6,
rpad('a',25,'-') bal_segment_value,
rpad('a',500,'-') inv_tid,
rpad('a',32,'-') invoice_type
, 'y' parent_cust --I WANT A NEW FIELD HERE TO BE VIEWED ON THE REPORT LAYOUT LATER
from dual
where 1=2
UNION ALL
&common_query_cus
Did i missed somthing 4 me to be able to add the field here? -
Camileo charging problem (solved) and a general question!
Hi all!
First of all, I was going to ask for help as to why the Camileo S10 was not charging (the orange light wasn't flashing), and I'd seen a few people with similar problems.
The solution?
Give the contacts on the battery a clean.
The insulation sticker that comes on it must leave some kind of residue on it, and it's enough to prevent charging. Now it's flashing away happily :]
So my general question was, is it possible/advisable to use the camera on the mains?
Rather than constantly draining and charging the battery during long shoots, I'd prefer to just leave it plugged in!
Thanks very much in advance!
PaulHi
I think the battery handling is always the same no matter what product it is
From time to time the battery should be recalibrated.
This means that the battery should be discharged fully and after then you should charge it again until the battery would reach 100%
I do this with all my batteries; mobile phone battery, digi cam battery and notebook battery. -
SAP CM25 which profile to use and why and some general questions
Hi there,
I have a few general questions, if you may share your thoughts on this.
In a manufacturing environment, is CM25 more used to finite schedule the work centers or labor or both ?
Is it a good idea to even finite schedule the planned orders or just production orders ? We want to create production orders 1 week ahead of the production schedule and planned orders gets created 3-4 weeks earlier than production order gets created.
The graphical tool seems to be slow sometimes when dispatching and doing some actions on the screen, has any one have any say on this. Should we need to have better computers on the floor for this to work ?
I have been trying my solutions using CM25 and not CM21 or CM27 using the profile SAPSFCG005, is there any other profile that I need to consider and other transactions to consider like CM21 or CM27 for certain purposes?
Thank youHello
In a manufacturing environment, is CM25 more used to finite schedule the work centers or labor or both ?
It can be used for both depend upon bottle neck resource whether machine or labour.
Is it a good idea to even finite schedule the planned orders or just production orders ? We want to create production orders 1 week ahead of the production schedule and planned orders gets created 3-4 weeks earlier than production order gets created.
Better it should be finite planning for planned order also you can use MRP with lead time scheduling.
The graphical tool seems to be slow sometimes when dispatching and doing some actions on the screen, has any one have any say on this. Should we need to have better computers on the floor for this to work ?
It depends upon the data load and selection,
Restrict the number of objects to be displayed, for example, select only a small number of work-centers/orders.
Customize the time profile (transaction OPD2) such that the database read period, the planning period and the evaluation period are as small as possible. As a result, fewer objects are read and displayed.
Refer KBA 2038780 - Tips for performance improvement on Capacity Leveling
If you want to process more orders, check whether a batch planning (planning in the background on transaction CM40) is possible.
I have been trying my solutions using CM25 and not CM21 or CM27 using the profile SAPSFCG005, is there any other profile that I need to consider and other transactions to consider like CM21 or CM27 for certain purposes?
It depends upon your requirements which transaction to use and which profile. You can customize your own profile also.
Best Regards,
R.Brahmankar -
Convergence and mshttpd general question
I've seen suggested on several posts here on this forum and from other Sun engineers that the mshttpd Webmail process should (must?) be run on the same server as Convergence. I didn't find this anywhere in the documentation for Convergence, so if it is there and I missed it, please point out where I overlooked it. For our Comm Suite 7 set up, we had provisioned 4 mail multiplexors (that run mshttpd), 4 mail message stores, and 2 Convergence front-end boxes. Our environment was officially approved by Sun Professional Services, so if this mshttpd/Convergence factor is so important, why wasn't it pointed out to us by S.P.S? Also, why does the Convergence setup let you specify a different hostname for the Web Mail server?
Thanks,
JimJimBuitt wrote:
I've seen suggested on several posts here on this forum and from other Sun engineers that the mshttpd Webmail process should (must?) be run on the same server as Convergence.The webmail process does not have to run on the same server as Convergence.
I didn't find this anywhere in the documentation for Convergence, so if it is there and I missed it, please point out where I overlooked it.http://wikis.sun.com/display/CommSuite7/Communications+Suite+7+Installation+Scenario+-+Convergence
<snip>
Recommended:
* Webmail Server component of Messaging Server 7 Update 2
We recommend that you install the Webmail Server on this host.
About Webmail Server
The best deployment practice is to place the Webmail Server on the same host as Convergence to provide horizontal scalability and enable smooth growth of services.
Note: From a functional perspective, Convergence provides complete mail service when the Webmail Server is located on a different host than Convergence. Therefore, in some deployments, the Webmail Server may be located on a different host.
Other Messaging Server components such as the message store and MTA, Calendar Server, and Instant Messaging Server may be located on other hosts.
</snip>
So whilst you can run the webmail processes on another system, you need to consider the value (CPU offloading) vs. the cost (network delay, additional point-of-failure). The webmail process doesn't consume much CPU resources compared to Convergence.
For our Comm Suite 7 set up, we had provisioned 4 mail multiplexors (that run mshttpd), 4 mail message stores, and 2 Convergence front-end boxes.Is there any documentation that has the webmail processes (used by Convergence) running behind a load-balancer? I can imagine a few scenarios where this will cause problems:
=> If a user session is processed by different front-ends then there may be synchronization issues e.g. an email marked "Read" in one webmail instance may be "Unread" in another.
=> The webmail services keep IMAP connections open for active sessions (where a logout hasn't occurred/session hasn't timed out). If Convergence is accessing different webmail front-ends for the same user then you could have multiple webmail sessions subsequently additional webmail => IMAP connections.
=> If you have a single problem webmail instance it will impact all Convergence front-ends "randomly" vs. having a single Convergence front-end failing all the time. The second scenario is much easier to diagnose/isolate.
In general it comes down to this -- don't make your environment more complex then it needs to be.
Regards,
Shane. -
Njawin - jcomgen and some general questions
Hi.
I'm currently evaluating njawin, and some questions came up:
Will there be a command line interface for jcomgen?
The interactive GUI isn't really suitable for an automated build process.
njawin compared to jawin:
njawin seems to be more advanced, but there's no source available.
Does anybody know if this will change in the future?
regards,
romanCarl,
The njawin distribution available for "evaluation" download around the web comes with no license, as it is a version of OLE for Java (OLEJA), a commercial product, which was developed before OLEJA went retail.
One thing you'll notice is that OLEJA and Njawin have remarkably similar APIs. If your application's functionality does not have very complex requirements, you can simply replace all references to "oleja" with "njawin", and all references to "compose" with "develop". This holds true for the generated .java files, the .xml file, etc. I am not sure if OLEJA introduces or uses more APIs than the ones that appeared in Njawin, but for my application, this approach was successful.
One other thing to keep in mind is that I don't see why you'd actually need to build your sources into a jar, if you simply include them in a larger package as part of your application's source code. Just put njawin.jar, njawin.dll, and yourdll.dll on the build path and the rest of your problems should be solved for you. Keep in mind that, since OLEJA is commercialized, it's been debugged a lot (as the author has stated in mailing lists) and that means Njawin could have some unexpected problems. In this case you should thoroughly test your usage of Njawin with your application to be sure it runs well in your environment. Errors that could potentially crash your JVM may appear when certain functionality (especially multi-threaded functionality) inside your ActiveX control is executed.
Regards
Sean McNamara -
Coding Problem 6 Now Defined in Scripting Languages/Bioinformatics WIKI
In the "Scripting Languages and Bioinformatics" WIKI, I have completed a new page here:
https://wiki.sdn.sap.com/wiki/display/EmTech/Bio-InformaticBasicsPartII-AlignmentToolsforRelatingProteinGenestoProteinPrimaryStructures
and also defined Coding Problem 6 at the end of this page.
This problem involves scripting an interactive session with a web site and parsing what the web site returns at various points duing the session.
Am looking foward to a script that solves this problem, if anyone feels like spending the time to do it.<?
// sequence to search ---------------------------------------------
$bquery = "MTQIIKIDPLNPEIDKIKIAADVIRNGGTVAFPTETVYGLGANAFDG";
$bquery .= "NACLKIFQAKNRPVDNPLIVHIADFNQLFEVAKDIPDKVLEIAQIVW";
$bquery .= "PGPLTFVLKKTERVPKEVTAGLDTVAVRMPAHPIALQLIRESGVPIA";
$bquery .= "APSANLATRPSPTKAEDVIVDLNGRVDVIIDGGHTFFGVESTIINVT";
$bquery .= "VEPPVLLRPGPFTIEELKKLFGEIVIPEFAQGKKEAEIALAPGMKYK";
$bquery .= "HYAPNTRLLLVENRNIFKDVVSLLSKKYKVALLIPKELSKEFEGLQQ";
$bquery .= "IILGSDENLYEVARNLFDSFRELDKLNVDLGIMIGFPERGIGFAIMN";
$bquery .= "RARKASGFSIIKAISDVYKYVNI";
// url for form1 --------------------------------------------------
$url = "http://blast.ncbi.nlm.nih.gov:80/Blast.cgi";
// parameters for form1 -------------------------------------------
$bdb = "protein";
$bgeneticcode= "1";
$bquery_from = "";
$bquery_to = "";
$bjobtitle = "ACW-" . time();
$bdatabase = "nr";
$bblastprog = "tblastn";
$bpagetype = "BlastSearch";
$pf = "";
$pf .= "QUERY=" . $bquery;
$pf .= "&db=" . $bdb;
$pf .= "&QUERY_FROM=" . $bquery_from;
$pf .= "&QUERY_TO=" . $bquery_to;
$pf .= "&JOB_TITLE=" . $bjobtitle;
$pf .= "&DATABASE=" . $bdatabase;
$pf .= "&BLAST_PROGRAMS=" . $bblastprog;
$pf .= "&PAGE_TYPE=" . $bpagetype;
$pf .= "&GENETIC_CODE=1";
$pf .= "&DBTYPE=";
$pf .= "&EQ_MENU=";
$pf .= "&EQ_TEXT=";
$pf .= "&NEWWIN=";
$pf .= "&MATCH_SCORES=";
$pf .= "&MAX_NUM_SEQ=100";
$pf .= "&EXPECT=10";
$pf .= "&WORD_SIZE=3";
$pf .= "&MATRIX_NAME=BLOSUM62";
$pf .= "&GAPCOSTS=11 1";
$pf .= "&COMPOSITION_BASED_STATISTICS=2";
$pf .= "&REPEATS=";
$pf .= "&FILTER=";
$pf .= "&LCASE_MASK=";
$pf .= "&TEMPLATE_LENGTH=";
$pf .= "&TEMPLATE_TYPE=";
$pf .= "&I_THRESH=0.005";
$pf .= "&CLIENT=web";
$pf .= "&SERVICE=plain";
$pf .= "&CMD=request";
$pf .= "&PAGE=Translations";
$pf .= "&PROGRAM=tblastn";
$pf .= "&MEGABLAST=";
$pf .= "&RUN_PSIBLAST=";
$pf .= "&SELECTED_PROG_TYPE=tblastn";
$pf .= "&SAVED_SEARCH=true";
$pf .= "&BLAST_SPEC=";
$pf .= "&QUERY_BELIEVE_DEFLINE=";
$pf .= "&DB_DIR_PREFIX=";
$pf .= "&SHOW_OVERVIEW=true";
$pf .= "&SHOW_LINKOUT=true";
$pf .= "&GET_SEQUENCE=true";
$pf .= "&FORMAT_OBJECT=Alignment";
$pf .= "&FORMAT_TYPE=HTML";
$pf .= "&ALIGNMENT_VIEW=Pairwise";
$pf .= "&MASK_CHAR=2";
$pf .= "&MASK_COLOR=1";
$pf .= "&DESCRIPTIONS=100";
$pf .= "&ALIGNMENTS=100";
$pf .= "&NEW_VIEW=true";
$pf .= "&OLD_BLAST=true";
$pf .= "&NCBI_GI=false";
$pf .= "&SHOW_CDS_FEATURE=false";
$pf .= "&NUM_OVERVIEW=100";
$pf .= "&FORMAT_EQ_TEXT=";
$pf .= "&FORMAT_ORGANISM=";
$pf .= "&EXPECT_LOW=";
$pf .= "&EXPECT_HIGH=true";
$pf .= "&QUERY_INDEX=0";
// define the HTTP connection -----------------------------
$ch = curl_init();
curl_setopt($ch,CURLOPT_URL,$url);
curl_setopt($ch, CURLOPT_POST, 1);
curl_setopt($ch,CURLOPT_POSTFIELDS, $pf);
curl_setopt($ch,CURLOPT_COOKIEJAR,
dirname(__FILE__).'/cookie.txt');
curl_setopt($ch,CURLOPT_FOLLOWLOCATION,1);
curl_setopt($ch, CURLOPT_HEADER , 1);
curl_setopt($ch, CURLOPT_RETURNTRANSFER,1);
// call it ------------------------------------------------
$my_result = curl_exec($ch);
// get the request ID; the query takes some time and this ID
// allows to identify the original request
$query = "/<tr><td>Request ID<\/td><td> <b>([0-9A-Z]*)<\/b><\/td><\/tr>/";
preg_match($query, $my_result, $request_id);
// query for the result page every 2 seconds...when the result
// is ready, we recognize it by its signature
$not_ready = true;
$result_url = "http://blast.ncbi.nlm.nih.gov/Blast.cgi?CMD=Get&VIEW_RESULTS=FromRes&RID=" . $request_id[1];
while($not_ready){
$temp_page = null;
curl_setopt($ch,CURLOPT_URL,$result_url);
curl_setopt($ch, CURLOPT_POST, 0);
$my_result = curl_exec($ch);
$query = "/This page will be automatically updated in <b>(\d*)<\/b> seconds/";
preg_match($query, $my_result, $temp_page);
if(isset($temp_page[1])) { sleep(2); }
else { $not_ready = false; }
// parse the results page; split it into result fragments first --------
$pat = "/";
$pat .= "><input type=\"checkbox\" name=\"getSeqGi\"([^\n]*)\n";
$pat .= "Length=\d*\n\n";
$pat .= "[\w\s]*:\n";
$pat .= "(\s*<a[^>]*>[^<]*<\/a>\n)*\n";
$pat .= "([^\n]*\n){3}\n";
$pat .= "(([^\n]*\n){3}\n[^n])*";
$pat .= "/";
preg_match_all($pat, $my_result, $fragments);
// 'fine parse the result fragments and get some important parameters -----
foreach($fragments[0] as $fragment){
$query = "/<a href=\"http:\/\/(www\.ncbi\.nlm\.nih\.gov\/entrez\/query\.fcgi\?";
$query .= "[^>]*)>([^<]*)<\/a><a[^>]*>[^<]*<\/a>\s*<a[^>]*><img[^>]*><\/a>([^\n]*)/";
preg_match($query, $fragment, $u);
$query = "/\s*Score\s*=\s*(\d*) bits\s*\(\d*\),\s*Expect\s*=\s*([^,]*),";
$query .= "[^\n]*\n\s*Identities\s*=\s*\d*\/\d*\s*\((\d*%)\)[^\n]*\n\s*Frame\s*=\s*([^\n]*)\n/";
preg_match($query, $fragment, $u1);
preg_match_all("/Sbjct\s*(\d*)\s*[A-Z\-]*\s*(\d*)\n/", $fragment, $positions);
$fr["url"] = $u[1];
$fr["shname"] = $u[2];
$fr["name"] = $u[3];
$fr["score"] = $u1[1];
$fr["expect"] = $u1[2];
$fr["identities"] = $u1[3];
$fr["frame"] = $u1[4];
// find out if we have to reverse the strand direction or not; adjust
// lower and upper limit
if ($fr["frame"] >= 0) {
$fr["high"] = $positions[2][count($positions)-1]; $fr["low"] = $positions[1][0]; $fr["reverse"] = ""; }
else {
$fr["high"] = $positions[1][0]; $fr["low"] = $positions[2][count($positions)-1]; $fr["reverse"] = true;}
$frx[] = $fr;
// we call the final details form for the top ranked result
// here we could loop over several results
curl_setopt($ch,CURLOPT_URL,$frx[0]["url"]);
curl_setopt($ch, CURLOPT_POST, 0);
$my_result = curl_exec($ch);
// parse the final details form to get the necessary parameters to execute
// the final details form
preg_match("/<input name=\"WebEnv\" type=\"hidden\" value=\"([^\"]*)\"/",
$my_result, $u5);
preg_match("/<input name=\"query_key\" type=\"hidden\" value=\"([^\"]*)\"/",
$my_result, $u6);
preg_match("/<input name=\"db\" type=\"hidden\" value=\"([^\"]*)\"/",
$my_result, $u7);
preg_match("/<input name=\"qty\" type=\"hidden\" value=\"([^\"]*)\"/",
$my_result, $u8);
preg_match("/<input name=\"c_start\" type=\"hidden\" value=\"([^\"]*)\"/",
$my_result, $u9);
preg_match(
"/<select name=\"dopt\".*<option value=\"([^\"]*)\" selected=\"1\">/",
$my_result, $u10);
preg_match(
"/<select name=\"dispmax\".*<option value=\"([^\"]*)\" selected=\"1\">/",
$my_result, $u11);
preg_match(
"/<select name=\"sendto\".*<option value=\"([^\"]*)\" selected=\"1\">/",
$my_result, $u12);
preg_match(
"/<input type=\"hidden\" id=\"([^\"]*)\" name=\"fmt_mask\".*value=\"([^\"]*)\"/",
$my_result, $u13);
preg_match(
"/<input type=\"checkbox\" id=\"truncate\" name=\"truncate\" value=\"([^\"]*)\"\/>/",
$my_result, $u14);
// fill in the necessary parameters parsed out now and earlier
$of = "WebEnv=" . $u5[1];
$of .= "&query_key=" . $u6[1];
$of .= "&db=" . $u7[1];
$of .= "&qty=" . $u8[1];
$of .= "&c_start=" . $u9[1];
$of .= "&dopt=" . $u10[1];
$of .= "&dispmax=" . $u11[1];
$of .= "&sendto=" . $u12[1];
$of .= "&fmt_mask=" . $u13[1];
$of .= "&truncate=" . $u14[1];
$of .= "&less_feat=";
$of .= "&from=" . $fr["low"];
$of .= "&to=" . $fr["high"];
$of .= "&strand=" . $fr["reverse"];
$of .= "&extrafeatpresent=1";
$of .= "&ef_SNP=1";
$of .= "&ef_CDD=8";
$of .= "&ef_MGC=16";
$of .= "&ef_HPRD=32";
$of .= "&ef_STS=64";
$of .= "&ef_tRNA=128";
$of .= "&ef_microRNA=256";
$of .= "&ef_Exon=512";
$of .= "&submit=Refresh";
$ourl = "http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?" . $of;
// execute the final details form
curl_setopt($ch,CURLOPT_URL,$ourl);
curl_setopt($ch, CURLOPT_POST, 0);
curl_setopt($ch,CURLOPT_POSTFIELDS, $of);
curl_setopt($ch,CURLOPT_FOLLOWLOCATION,1);
curl_setopt($ch, CURLOPT_HEADER , 1);
curl_setopt($ch, CURLOPT_RETURNTRANSFER,1);
$my_result = curl_exec($ch);
// parse the result page and get the final ORIGIN snippet
preg_match("/ORIGIN\s*\n\s*<a name=\"[^\"]*\"><\/a>\s*([^\/]*)\//", $my_result, $u99);
// output the final result ----------------------------------
echo "\n" . preg_replace("/\s{2,}/", "\n", preg_replace("/\d+\s/", "", $u99[1]));
?>
Edited by: Anton Wenzelhuemer on Aug 6, 2008 8:08 PM (Re-Formatted) -
I did the latest update to my I pad 2 and lost Safari . I was instructed to switch the Java script on which I did but Safari is still not working properly . how do I get everything back after this software update.
Try a reset: hold down the home button along with the power button until you see the Apple, then let go.
-
I updated iTunes 10.3.1 today, and now it won't let me openitunes it keeps saying error 7 (windows error 14001) and also says (apple mobile failed to startverify significant privileges to start system services) I have unstalled it severaltimes, tried repairing it also switched off all security software and checkedall files are deleted in local disk (program file) but still no look. Please cansomeone help
For general advice see Troubleshooting issues with iTunes for Windows updates.
The steps in the second box are a guide to removing everything related to iTunes and then rebuilding it which is often a good starting point unless the symptoms indicate a more specific approach. Review the other boxes and the list of support documents further down the page in case one of them applies.
The further information area has direct links to the current and recent builds in case you have problems downloading, need to revert to an older version or want to try the iTunes for Windows (64-bit - for older video cards) release as a workaround for performance issues or compatibility with QuickTime or third party software.
Your library should be unaffected by these steps but there are also links to backup and recovery advice should it be needed.
Regarding AMDS failures there is a hint in another thread that disabling the Windows Firewall before attempting to reinstall may help, otherwise take a look at the steps outlined in this post. Re: Can't install iTunes 12.1 on Windows 7 64-bit. I know they look a little daunting, but the process of generating the logs themselves isn't that hard to do. Extracting useful information from them is still a challenge but maybe something will leap out. If you want to post the log for the failed components for me to have a look at here or in the other thread please edit out any personal information, particularly your email address, first.
tt2 -
Said it all above. It tells me I have the latest version in the help tab under About Firefox. I have upgrade like 4 times now I even unistalled firefox and reinstaled the latest version But no change It still says i am out of date. like I said above on the addon pages I cant get what i want as it says I still have version 3.6 Help please I love firefox and hate IE but it works way better at the moment
Reset your User Agent. See the following articles:
*[https://support.mozilla.com/en-US/kb/websites%20or%20add-ons%20incorrectly%20report%20incompatible%20browser#w_reset-your-user-agent Websites or add-ons incorrectly report incompatible browser-Reset your user agent]
*What is a User Agent: http://en.wikipedia.org/wiki/User_Agent
'''If this reply solves your problem, please click "Solved It" next to this reply when <u>signed-in</u> to the forum.'''
Not related to your question, but...
You need to update some plug-ins:
*Plug-in check: https://www-trunk.stage.mozilla.com/en-US/plugincheck/
*Adobe Shockwave for Director Netscape plug-in: [https://support.mozilla.com/en-US/kb/Using%20the%20Shockwave%20plugin%20with%20Firefox#w_installing-shockwave Installing ('''''or Updating''''') the Shockwave plugin with Firefox]
*Next Generation Java Plug-in for Mozilla browsers: [https://support.mozilla.com/en-US/kb/Using%20the%20Java%20plugin%20with%20Firefox#w_installing-or-updating-java Installing or Updating Java in Firefox]
Does not relate to your question, but...
You have multiple old Java Console extensions that Java did not clean-up during updates. You need Java Console only if you do Java programming/development or debug Java applets on web pages. You can see them in Add-ons > Extensions, '''''but you can not remove them from there'''''. Removing them will not affect the functioning of Java on websites. You can '''''manually''''' remove them, '''''if you do not do Java development work''''' to avoid future, possible problems/conflicts:
*http://kb.mozillazine.org/Java#Multiple_Java_Console_extensions
Your old Java Console extensions:
*Java Console 6.0.13 {CAFEEFAC-0016-0000-0013-ABCDEFFEDCBA}
*Java Console 6.0.14 {CAFEEFAC-0016-0000-0014-ABCDEFFEDCBA}
*Java Console 6.0.15 {CAFEEFAC-0016-0000-0015-ABCDEFFEDCBA}
*Java Console 6.0.17 {CAFEEFAC-0016-0000-0017-ABCDEFFEDCBA}
*Java Console 6.0.19 {CAFEEFAC-0016-0000-0019-ABCDEFFEDCBA}
*Java Console 6.0.20 {CAFEEFAC-0016-0000-0020-ABCDEFFEDCBA}
*Java Console 6.0.21 {CAFEEFAC-0016-0000-0021-ABCDEFFEDCBA}
*Java Console 6.0.22 {CAFEEFAC-0016-0000-0022-ABCDEFFEDCBA}
*Java Console 6.0.23 {CAFEEFAC-0016-0000-0023-ABCDEFFEDCBA}
*Java Console 6.0.24 {CAFEEFAC-0016-0000-0024-ABCDEFFEDCBA} -
Windows Update story - how it's made and how evolved!
I am searching for as much information as possible about Windows Update. When it was realeased for the first time, how it evolved to this moment, what was the first update, is there something more than security tuesday patch, everything that could give me full
overview of it. I thout it will be easy but it is quiet hard to find such info.
I will really appreaciate for sources, books, links info.
Thanks in advance!Hello,
The TechNet Wiki Discussion Forum is a place for the TechNet Wiki Community to engage, question, organize, debate, help, influence and foster the TechNet Wiki content, platform and Community.
Please note that this forum exists to discuss TechNet Wiki as a technology/application.
As it's off-topic here, I am moving the question to the
Where is the forum for... forum.
Karl
When you see answers and helpful posts, please click Vote As Helpful, Propose As Answer, and/or Mark As Answer.
My Blog: Unlock PowerShell
My Book:
Windows PowerShell 2.0 Bible
My E-mail: -join ('6F6C646B61726C406F75746C6F6F6B2E636F6D'-split'(?<=\G.{2})'|%{if($_){[char][int]"0x$_"}}) -
Debugging SAP Scripts MR_PRINT and MR_REKL
Hi All,
Can anybody tell me if there is an easy way to debug the SAP Script Layoutsets MR_PRINT and MR_REKL, which are triggered through MRKO and MIRO transactions. Also I need to know how to repeat the print out of the above layouts, which are outputs of Invoice reductions and Invoice corrections.
I already tried SE71 -> Utilities -> Activate Debugger and also placing a break-point in one of the performs, I call, but I think the print program is a dynamic call and it is not stopping at the break-points.
Let me know what I am missing.
Thank you for your time,
yrkanthSorry, if it sounds dumb. But how will you put a hard breakpoint in a SAP Script? I don't hink there is a BREAK-POINT command which can be used in SAP Script? I activated the sap script debugger and am running the MRKO transaction which triggers the layoutset, but it is not stopping as it does stop for any other layouset.
The other way I tried was, to put in BREAK-POINT command in one of the performs the SAP script calls and I was able to stop at that only when I debug in Update debugging mode. This only allows me to debug the perform code but it still does not allow me to debug the script as we debug the script for PO (Purchase Order) by activating the SAP Script debugger and print previewing the PO.
Hope this helps?
I really appreciate your time.
Thank you,
yrkanth -
Update command in Shell script
Hi friends
sqlplus -s / <<END
set feedback on;
update tran2 set sno=1;
exit;
END
when i am using update command in shell script like above
it is updating the database well...but i just want to know how many rows it is updating and i dont want to commit
for that
sqlplus -s / <<END
set feedback on;
update tran2 set sno=1;
set feedback off;
rollback;
exit;
END
It's working fine
is there any other method to do the sameWell what's exactly your requirement? The current requirement doesn't make a lot of sense.
How many row is going to be updated depends on where clause, if you have no where clause that essentially updating whole table, the number of row updated is count of your rows. -
Hello,
I'm experiencing some issues with Firefox 16.0.1 which I had also experienced with Firefox 15.0.1.
On numerous occasions Firefox has crashed while attempting to access a website link contained in an AOL e-mail message.
Unrelated to that issue, Firefox has hung up frequently with associated unresponsive script warnings and occasionally with the Adobe Flash Plugin crashing. Some of the unresponsive script warnings are:
http://connect.facebook.net/en_US/all.js:127
http://e.huffpost.com/elections/assets/pregeneral_rr.js?d2e0923f3d19471c9e93c391a701ef30e3f427e8:1
http://o.aolcdn.com/cdn.webmail.aol.com/37001/js/dojo-custom/dojo/dojo.xd.js:102
http://o.aolcdn.com/cdn.webmail.aol.com/37001/js/dojo-custom/dojo/dojo2.xd.js:14
http://o.aolcdn.com/cdn.webmail.aol.com/37043/js/dojo-custom/dojo/MessageList.xd.js:52
http://o.aolcdn.com/cdn.webmail.aol.com/37092/js/dojo-custom/dojo/dojo.xd.js:102
http://o.aolcdn.com/cdn.webmail.aol.com/37092/js/dojo-custom/dojo/dojo.xd.js:122
http://o.aolcdn.com/cdn.webmail.aol.com/37092/js/dojo-custom/dojo/dojo2.xd.js:516
http://o.aolcdn.com/cdn.webmail.aol.com/37092/js/dojo-custom/dojo/dojo.xd.js:70
http://o.aolcdn.com/cdn.webmail.aol.com/37092/js/dojo-custom/dojo/dojo3.xd.js:45
http://o.aolcdn.com/cdn.webmail.aol.com/37092/js/dojo-custom/dojo/dojo3.xd.js:76
http://q.aolcdn.com/cdn.webmail.aol.com/37001/js/dojo-custom/dojo/dojo2.xd.js:940
http://partner.googleadservices.com/gampad/google_ads_gpt.js:12
I've reset Firefox and disabled all the plugins and yet these problems persist.
What are those script warnings actually telling me and are there any recommendations on how to resolve these issues?
Thank you,
MikeYou can check for problems caused by recent Flash updates and try these:
*disable a possible RealPlayer Browser Record Plugin extension for Firefox and update the RealPlayer if installed
*disable protected mode in Flash 11.3 and later
*disable hardware acceleration in the Flash plugin
*http://kb.mozillazine.org/Flash#Troubleshooting
*https://support.mozilla.org/kb/flash-113-doesnt-load-video-firefox -
When I try to go to ilcoud I get 'script problem' and can't enter. Please advise what I should try. Thanks.
I use e-trade and a couple of times, years back, I found them behind the Java updates.
So, now I install new Java platforms on my backup disk and test the streaming data on that first because I know it will be over-written that evening with my nightly backup.
Of course, since I began doing that there hasn't been a problem. Do the same with printer driver updates.
Anyway, call ScottTrade and howl! Tell them how many Macs are out there and why aren't they in Apple Developers Program?
Maybe you are looking for
-
Accessing a file without the .xpj
A former coworker created a project in RoboHelp 8. She is no longer with the company so the project passed to me. For the life of me, I cannot find the .xpj file for this project. Is there a way for me to access this without the xpj? I'm coming up em
-
Installing 3rd party application in Portal
Hi, We are running on NW Portal 7.0. Presnetly I have one req to install one Java application in Portal. I got a war file from the developer. now the problem here is the developer used mysql database to do the coding. Now we want to use SQL server200
-
Am I able to use my Blackberry as a Internet sourse for my iPad
Does anyone know if I can use my Sprint BlackBerry and a internet sourse with my iPad
-
How does the whole authentication on Oracle Forms work? DB: *10gR2* FORMS: On AS10g; so I presume that's the version of Forms. I can see the properties in FORMSWEB.CFG+ [htmlconfig] userid=%H_Username%/%H_Password%@%H_DBalias% When the Oracle Develop
-
Hi! I have a jsp page which has a comment textarea. user can enter comment in it. when submitted comment gets stored into database. and in next jsp page comment filed same comment gets retrieved from database and gets displayed. my problem is: 1>supp