Devices in profile manager not showing
I have profile manager set up and I have tried to enroll the device, but it does not show in the devices panel. I want to use profile manager to manage the devices, not so much the users. These macs are on a cart and they are bound to active directory and many students login to them on any given day. I also set up a default user so that they all get the same look and cannot change any settings. I am stumped. I was trying to find a log to look at but not sure where to start to trouble shoot. Suggestions would be appreciated I am running os x 10.7.4 lion server. Thanks
You should probably move this post to The OS X Server part of Apple Discussions.
https://discussions.apple.com/community/servers_enterprise_software/os_x_server
I don't have the clearance to actually move the post.
Similar Messages
-
Users added to Profile Manager not showing up in everyone group
So profile manager was working quite well until I made a change to the workgroup group.
I removed the password policy from the workgroup group and added a new group for the password policy so we could essentially still manage non user assigned iOS devices.
Now when I add a new user to the workgroup group on the server I have them login to the mydevices site so we can enroll the device and they can login but are immediately presented with:
"You do not have permission to access the page you were looking for. Contact your system administrator."
In troubleshooting the issue I noticed that new users being added are not showing up the in the everyone group which is preventing the users from having proper access. Prior to all this I could add a user and they would show up in everyone as intended.
Any thoughts?I'm not sure if this is the same issue, but I have a user in Server.app that is not showing up in Users group. She is listed in her sub-group, but I cannot add devices to her account. When I click on the arrow next to her name in the sub-group, it takes me to the Users list to the top user.
Any thoughts? -
Profile manager not working? iOS 6
I have mac mini working as Mountain Lion Server 10.8.2, Server.app 2.1 (upgraded from 10.7.4 Server)
(All services are using 3rd party ssl certificates)
previously enrolled devices are getting push changes.
I got a new iphone 4 (service upgrade) with ios6, and when i enroll it, it gets a name: New Device in profile manager
Not the name that it has been named. And the push settings arent pushed. Other devices do get changes.
I got the right name for the iphone to profile manager, by filling the data as a place holder device. Then it got the
right name for the device. But push payloads are not working.the device logs gets 500 error code, you van see this in iphone configuration utility or in apple configurator.
as follows in console:
"US Desc: A transaction with the server at “https://server.com/devicemanagement/api/device/connect” has failed with the status “500”.
Domain : MCHTTPTransactionErrorDomain
Code : 23001
Type : MCFatalError -
Can't enroll devices with Profile Manager - invalid key
n my case I can install profiles on devices from Profile Manager page but I cannot enroll devices.
The certificate I download to enroll is reject by my MacBook Pro Lion: Says Invalid blablabla at the end:
Now I have done log research and I now exactly and understand why it doesn't work:
the scep_helper daemon is supposed to listen to port 1640 TCP (which you should forward to your server by the way, if you want to be able to enroll devices) and provide the requsting client the root CA that signed the certificate. In my case, it can't find the root CAT to provide the client with so it can finalize the cert validation process.
In my case, that's what I see in the log:
Jul 29 02:12:44 teknologism scep_helper[1638]: SCEP_HELPER: /SourceCache/RemoteDeviceManagement/RemoteDeviceManagement-701.70/scep_helper/m ain.m:727 'status = SCEPGetCACert(session, NULL, 0)' = -25300
Jul 29 02:12:44 teknologism scep_helper[1638]: SCEP_HELPER: /SourceCache/RemoteDeviceManagement/RemoteDeviceManagement-701.70/scep_helper/m ain.m:513 'SCEPGetCACert(session, NULL, 0)' = -25300
Jul 29 02:12:44 teknologism scep_helper[1638]: SCEP_HELPER: /SourceCache/RemoteDeviceManagement/RemoteDeviceManagement-701.70/scep_helper/m ain.m:819 'challenge = GetChallengeFromSCEP(password, guid, hostURL)' is NULL
Jul 29 02:12:44 teknologism ProfileManager[516]: Could not retrieve root certificate from open directory server.
No , as for the bad news: I have no idea on how to fix. Have dug into scep_helper, googled etc. Not a single clue on how to check it's configuration or even why it can't find the root CA. By the way everyhting else (I really mean everything, ical,cardav,web,wiki etc.) work great. And profile manager too, it's just the enroll thingy that doesn't work. And the root CA cert is in /etc/certificates. My server a legit Class 1 SSL cert signed by a system trsuted CA (Startfiel to name it)
I have tried with other certs etc... It's a no go.
Can anyone help ??
How can I add that missing CA Cert in opendirectory ?Here is some more infos...
teknologism:root root# serveradmin settings devicemgr
devicemgr:SSLAuthorityChain = "/etc/certificates/trinity.teknologism.org.C1D19D55699B48C94A18787E4F53B4C3230E 91FE.chain.pem"
devicemgr:od_active = yes
devicemgr:ssl_active = yes
devicemgr:enableCodeSigning = yes
devicemgr:updated_at = 2011-07-28 16:04:52 +0000
devicemgr:email_delivery_method = ""
devicemgr:CodeSigningPrivateKey = "/etc/certificates/teknologism.org Code Signing Certificate.ED29CE4BD9D2926D64E60EF7A117EFDB2213F0CC.key.pem"
devicemgr:apns_active = yes
devicemgr:CodeSigningAuthorityChain = "/etc/certificates/teknologism.org Code Signing Certificate.ED29CE4BD9D2926D64E60EF7A117EFDB2213F0CC.chain.pem"
devicemgr:default_profile_created_at_least_once = yes
devicemgr:knob_sets_enabled:com.apple.mail.managed = yes
devicemgr:knob_sets_enabled:com.apple.vpn.managed = yes
devicemgr:knob_sets_enabled:com.apple.carddav.account = yes
devicemgr:knob_sets_enabled:com.apple.jabber.account = yes
devicemgr:knob_sets_enabled:com.apple.caldav.account = yes
devicemgr:email_authentication = ""
devicemgr:email_port = 25
devicemgr:email_username = ""
devicemgr:id = 1
devicemgr:last_modified_guid = ""
devicemgr:SSLPrivateKey = "/etc/certificates/trinity.teknologism.org.C1D19D55699B48C94A18787E4F53B4C3230E 91FE.key.pem"
devicemgr:od_master = "127.0.0.1"
devicemgr:apns_topic = ""
devicemgr:email_password = ""
devicemgr:mdm_acl = 2047
devicemgr:user_timeout = 43200
devicemgr:server_organization = ""
devicemgr:SSLCertificate = "/etc/certificates/trinity.teknologism.org.C1D19D55699B48C94A18787E4F53B4C3230E 91FE.cert.pem"
devicemgr:created_at = 2011-07-24 11:47:33 +0000
devicemgr:email_address = ""
devicemgr:email_domain = ""
devicemgr:CodeSigningCertificate = "/etc/certificates/teknologism.org Code Signing Certificate.ED29CE4BD9D2926D64E60EF7A117EFDB2213F0CC.cert.pem"
devicemgr:email_server_address = ""
devicemgr:admin_session = ""
The 3 CodeSigning certs/keys are in /etc/certificates and their permissions are correct.
Also, don't ask me why but my ProfileManager pane in Server.app is working again. It shows all the config...but can't modify anything....as soon as I try to modify it spins the waiting whell forever... I guess it's the same error as command line serveradmin... -
Profile Manager not quite loading...
Hi all,
I have a question about Profile Manager not loading on a fresh install. I've got this working in the past, but don't ask me how as I don't know anymore, plus the conditions were different.
Now when I go to https://server.example.com/profilemanager or /mydevices I can't even log in and it doesn't show anything. The status bar in Safari shows that 5 out of 7 items have been loaded and when I view the source, it shows:
<!DOCTYPE html><html> <head> <script> var _SC_performanceEvents = { headStart: new Date().getTime() }; </script> <meta http-equiv="Content-type" content="text/html; charset=utf-8" /> <meta http-equiv="X-UA-Compatible" content="IE=8" /> <meta http-equiv="Content-Script-Type" content="text/javascript" /> <meta name="apple-mobile-web-app-capable" content="yes" /> <meta name="apple-mobile-web-app-status-bar-style" content="default" /> <meta name="viewport" content="initial-scale=1.0, minimum-scale=1.0, maximum-scale=1.0, user-scalable=no" /> <link rel="apple-touch-icon" href="/devicemanagement/console/sproutcore/foundation/en/b74a542f762e55107620d6f19465a 4ec3258c4df/images/sproutcore-logo.png" /> <link rel="apple-touch-startup-image" media="screen and (orientation:portrait)" href="/devicemanagement/console/sproutcore/foundation/en/b74a542f762e55107620d6f19465a 4ec3258c4df/images/sproutcore-startup-portrait.png" /> <link rel="apple-touch-startup-image" media="screen and (orientation:landscape)" href="/devicemanagement/console/sproutcore/foundation/en/b74a542f762e55107620d6f19465a 4ec3258c4df/images/sproutcore-startup-landscape.png" /> <link rel="shortcut icon" href="" type="image/x-icon" /> <title>Admin</title> <script type="text/javascript">/* >>>>>>>>>> BEGIN source/core.js */// ==========================================================================// Project: SproutCore - JavaScript Application Framework// Copyright: ©2006-2009 Sprout Systems, Inc. and contributors.// Portions ©2008-2009 Apple Inc. All rights reserved.// License: Licensed under MIT license (see license.js)// ==========================================================================
/* >>>>>>>>>> BEGIN source/system/browser.js */// ==========================================================================// Project: SproutCore - JavaScript Application Framework// Copyright: ©2006-2009 Sprout Systems, Inc. and contributors.// Portions ©2008-2009 Apple Inc. All rights reserved.// License: Licensed under MIT license (see license.js)// ==========================================================================
var SC = SC || { BUNDLE_INFO: {}, LAZY_INSTANTIATION: {} };
SC.browser = (function() { var userAgent = navigator.userAgent.toLowerCase(), version = (userAgent.match( /.+(?:rv|it|ra|ie)[\/: ]([\d.]+)/ ) || [])[1] ;
var browser = { version: version, safari: (/webkit/).test( userAgent ) ? version : 0, opera: (/opera/).test( userAgent ) ? version : 0, msie: (/msie/).test( userAgent ) && !(/opera/).test( userAgent ) ? version : 0, mozilla: (/mozilla/).test( userAgent ) && !(/(compatible|webkit)/).test( userAgent ) ? version : 0, mobileSafari: (/apple.*mobile.*safari/).test(userAgent) ? version : 0, chrome: (/chrome/).test( userAgent ) ? version : 0, windows: !!(/(windows)/).test(userAgent), mac: !!((/(macintosh)/).test(userAgent) || (/(mac os x)/).test(userAgent)), language: (navigator.language || navigator.browserLanguage).split('-', 1)[0] }; browser.current = browser.msie ? 'msie' : browser.mozilla ? 'mozilla' : browser.safari ? 'safari' : browser.opera ? 'opera' : 'unknown' ; return browser ;})();
/* >>>>>>>>>> BEGIN source/system/bench.js */// ==========================================================================// Project: SproutCore - JavaScript Application Framework// Copyright: ©2006-2010 Sprout Systems, Inc. and contributors.// Portions ©2008-2010 Apple Inc. All rights reserved.// License: Licensed under MIT license (see license.js)// ==========================================================================
// sc_require("system/browser")if (typeof _SC_performanceEvents !== "undefined") { SC._performanceEvents = _SC_performanceEvents; _SC_performanceEvents = undefined;} else { SC._performanceEvents = { headStart: new Date().getTime() };}/* >>>>>>>>>> BEGIN source/system/loader.js */// ==========================================================================// Project: SproutCore - JavaScript Application Framework// Copyright: ©2006-2009 Sprout Systems, Inc. and contributors.// Portions ©2008-2009 Apple Inc. All rights reserved.// License: Licensed under MIT license (see license.js)// ==========================================================================
// sc_require("system/browser");
SC.bundleDidLoad = function(bundle) { var info = this.BUNDLE_INFO[bundle] ; if (!info) info = this.BUNDLE_INFO[bundle] = {} ; info.loaded = true ;};
SC.bundleIsLoaded = function(bundle) { var info = this.BUNDLE_INFO[bundle] ; return info ? !!info.loaded : false ;};
SC.loadBundle = function() { throw "SC.loadBundle(): SproutCore is not loaded."; };
SC.setupBodyClassNames = function() { var el = document.body ; if (!el) return ; var browser, platform, shadows, borderRad, classNames, style; browser = SC.browser.current ; platform = SC.browser.windows ? 'windows' : SC.browser.mac ? 'mac' : 'other-platform' ; style = document.documentElement.style; shadows = (style.MozBoxShadow !== undefined) || (style.webkitBoxShadow !== undefined) || (style.oBoxShadow !== undefined) || (style.boxShadow !== undefined); borderRad = (style.MozBorderRadius !== undefined) || (style.webkitBorderRadius !== undefined) || (style.oBorderRadius !== undefined) || (style.borderRadius !== undefined); classNames = el.className ? el.className.split(' ') : [] ; if(shadows) classNames.push('box-shadow'); if(borderRad) classNames.push('border-rad'); classNames.push(browser) ; classNames.push(platform) ; if (parseInt(SC.browser.msie,0)==7) classNames.push('ie7') ; if (SC.browser.mobileSafari) classNames.push('mobile-safari') ; if ('createTouch' in document) classNames.push('touch'); el.className = classNames.join(' ') ;} ;
/* >>>>>>>>>> BEGIN bundle_loaded.js */; if ((typeof SC !== 'undefined') && SC && SC.bundleDidLoad) SC.bundleDidLoad('sproutcore/bootstrap');
</script>
<link href="/devicemanagement/console/sproutcore/en/a8b61437c15a278078f3fffb972489104026f783 /stylesheet-packed.css" rel="stylesheet" type="text/css" /> <link href="/devicemanagement/console/apple_theme_v2/en/63cd5f0fb706373f354a879d93bb4f0dc898 b2b2/stylesheet.css" rel="stylesheet" type="text/css" /> <link href="/devicemanagement/console/admin/en/0803f0af1163f6efa8d9d71f0cc7179d84da0f27/styl esheet.css" rel="stylesheet" type="text/css" /> <script> SC._performanceEvents['headEnd'] = new Date().getTime(); </script> </head> <body class="apple-theme-v2 focus"> <script> SC._performanceEvents['bodyStart'] = new Date().getTime(); </script><script type="text/javascript">/* >>>>>>>>>> BEGIN source/setup_body_class_names.js */// ==========================================================================// Project: SproutCore - JavaScript Application Framework// Copyright: ©2006-2009 Sprout Systems, Inc. and contributors.// Portions ©2008-2009 Apple Inc. All rights reserved.// License: Licensed under MIT license (see license.js)// ==========================================================================
// sc_resource('setup_body_class_names'); // publish into inline format
if (SC.setupBodyClassNames) SC.setupBodyClassNames() ;
</script>
<script type="text/javascript" src="/devicemanagement/console/sproutcore/en/a8b61437c15a278078f3fffb972489104026f783 /javascript-packed.js"></script> <script type="text/javascript" src="/devicemanagement/console/apple_theme_v2/en/63cd5f0fb706373f354a879d93bb4f0dc898 b2b2/javascript.js"></script> <script type="text/javascript" src="/devicemanagement/console/admin/en/0803f0af1163f6efa8d9d71f0cc7179d84da0f27/java script.js"></script><script type="text/javascript">String.preferredLanguage = "en";</script>
<script> SC._performanceEvents['bodyEnd'] = new Date().getTime(); </script> </body></html>
...which looks fine to me. My question is: why doesn't the page show up at all (ultimately it fails)?
I have included a screen print of my server's server.app below:
Thanks in advance.I had multiple IP's set on my server, which randomly seemed to switch. It seems like there is an incompatibility still between Server Admin and server.app. Since Apple is pressing developers to test server admin and server.app I am confident those problems will resolve eventually, but for now I have deleted all-but-1 IPv4 and 1 IPv6 address (same interface), the networking interface overview for my server within Server Admin was updated and it looks like it works solid now, this was not by design I presume, so this must be another bug plaguing Lion...
After upgrading Postgres to 9.1.3 and upgrading webmail (upgrade: usr/share/webmail) from www.roundcube.net, making a new site webmail.example.com with the files stored in /Library/Server/Web/Data/Sites/CustomSitesDefault/webmail/ I made a symbolic link from that 'directory' to the actual built in webmail facility found in /usr/share/webmail by entering the following in terminal.
ln -s -i /usr/share/webmail/ /Library/Server/Web/Data/Sites/CustomSitesDefault/webmail/
By doing this it will ask to remove a directory, if you didn't put any important files in there, which I presume you didn't, confirm with the letter y and press enter.
Webmail now works every time the way I want it The same goes for Profile Manager, at least for now... -
Purge a device from Profile Manager
Is there a way to completely remove any record of a device from profile manager ?
Problem: I have two phones which were managed/supervised by Profile Manager/Configurator but were then reset and deleted from Profile Manager. BUT for some reason their SIMs have been swapped so when I reinstate them on Profile Manager it gets confused as it seems to have "remembered" each phone but using its old number i.e. the number on the SIM swapped to the other phone. As a result we cannot push any settings to those phones (they do enrol though).
Any ideas?You're not going crazy :)
There were a few posts about this problem along with a fix being posted
The fix consisted of manually purging the sim/iphone records from the profile manager database via terminal
From memory the method changed when mountain lion was released, the old method didn't work
Sorry I can't find the post that referred to the fix
This problem persisted from lion to mountain lion, I'm not sure if it's been fixed -
Profile Manager Not Loading - auth_token doesn't exit
We've have an instance of Server 3.1.2 where the Profile Manager login is no longer working, so we are effectively locked out of profile manager for the time being :-(.
On the front-end, visiting the /profilemanager login page redirects to (FQDN in place of our actual domain):
auth?redirect=https://FQDN/devicemanagement/api/authentication/callback
and the page then hangs forever and never gets to the login prompt. Occasionally the login prompt will display but nothing happens after the credentials are entered.
On the back-end, the profile manager log shows the following entries that coincide with the hanging of the login pages:
[91384] [2014/08/20 01:43:46.401] I: Processing MagicController#do_magic (for 10.XXX.XXX.XXX at 2014-08-20 01:43:46) [POST]
[91384] [2014/08/20 01:43:46.402] I: auth_token doesn't exist
[91384] [2014/08/20 01:43:46.402] I: Filter chain halted as [:verify_auth_token] rendered_or_redirected.
Other services on the server (e.g., DNS and Open Directory) seem to be operating normally. On other threads I've seen a suggestion to replace the FQDN with the IP, but that's yields the same result for us.
Any ideas? This one is driving us nuts!
Thanks for any input.I had multiple IP's set on my server, which randomly seemed to switch. It seems like there is an incompatibility still between Server Admin and server.app. Since Apple is pressing developers to test server admin and server.app I am confident those problems will resolve eventually, but for now I have deleted all-but-1 IPv4 and 1 IPv6 address (same interface), the networking interface overview for my server within Server Admin was updated and it looks like it works solid now, this was not by design I presume, so this must be another bug plaguing Lion...
After upgrading Postgres to 9.1.3 and upgrading webmail (upgrade: usr/share/webmail) from www.roundcube.net, making a new site webmail.example.com with the files stored in /Library/Server/Web/Data/Sites/CustomSitesDefault/webmail/ I made a symbolic link from that 'directory' to the actual built in webmail facility found in /usr/share/webmail by entering the following in terminal.
ln -s -i /usr/share/webmail/ /Library/Server/Web/Data/Sites/CustomSitesDefault/webmail/
By doing this it will ask to remove a directory, if you didn't put any important files in there, which I presume you didn't, confirm with the letter y and press enter.
Webmail now works every time the way I want it The same goes for Profile Manager, at least for now... -
CUSTOM ICC PROFILES DO NOT SHOW UP IN PSCS 6 MAC OS 10.8.4 BUT ARE OK IN CS5
The only icc profiles that show up in CS 6 Mac OS 10.8.4 are the ones that are installed from the printer driver ( Epson 9900 ) Any other single or custom profiles do not show up when placed Library/Colorsync/Profiles
All profiles show up in CS 5, There has been a lot of discussion of this on many forums with no solution. I have also tried installing the profiles in the contents folder of the Epson printer in the main library folder with no luck. Please adviseMac OS 10.8.4 is still in beta. You need to be reporting this to Apple.
What happens if you move these profiles to the Adobe/Profiles folder, or the users/Library/Colorsync/Profiles folder?
There has been a lot of discussion of this on many forums with no solution.
What forums? A google search turns up nothing but this thread.
I have not seen this problem with the released versions of 10.8. -
Camera Calibration Profiles do not show in Develop Module LR5 / Windows 7
I have selected three specific camera profiles (Nikon D300, Nikon D700 and Canon G12) and placed them into:
c:\Users\{me}\AppData\Roaming\Adobe\CameraRaw\CameraProfiles\{Nikon D800}
I restarted Lightroom 5 and viewed a RAW photo (not jpg or tif).
But my Nikon D800 or the other two camera profiles do not show up in the Develop Module Camera Calibration drop down menu, nor in the Presets drop down in the Navigator panel.
What am I doing wrong?DdeGannes wrote:
It is possible to have third party software providers create profiles for your camera that simulate other camera profiles. I have had that done for my Olympus E520 and E300 cameras so that I have dozens of option available.
Yes (to a degree). You can build your own custom DNG camera profiles, that's a good first start. Then you could edit them using the free DNG Profile Editor from Adobe. I'd start with custom profiles for each camera and see if that produces an acceptable match among them.
This may help too:
In this 30 minute video, we’ll look into the creation and use of DNG camera profiles in three raw converters. The video covers:
What are DNG camera profiles, how do they differ from ICC camera profiles.
Misconceptions about DNG camera profiles.
Just when, and why do you need to build custom DNG camera profiles?
How to build custom DNG camera profiles using the X-rite Passport software.
The role of various illuminants on camera sensors and DNG camera profiles.
Dual Illuminant DNG camera profiles.
Examples of usage of DNG camera profiles in Lightroom, ACR, and Iridient Developer.
Low Rez (YouTube):
http://youtu.be/_fikTm8XIt4
High Rez (download):
http://www.digitaldog.net/files/DNG%20Camera%20profile%20video.mov -
Spotify name and profile picture not showing publicly
I have linked my Facebook account to a new Spotify account that I made after my old one was compromised. I have since recovered my compromised account via support. My facebook account was disconnected by whoever hijacked the account. I signed up for premium on this new account and intend to continue using it. After syncing with facebook on this new account and adding contacts, my profile picture and name show correctly on the desktop client and phone but my public profile does not show either my name or picture. Is there anything I can do to remedy this problem or do I have to wait for the servers to update? Thanks. Edit: old spotify username was John007H the new one is John007H2 (this account).
Antohny,
Also be patient. It can take several days, before the uploaded image is approved, and shows. My two red wine glasses image took about 7-10 days, and this one about 5.
IIRC, in my profile, I had "(pending)" showing during that time.
Good luck,
Hunt -
How to rename registered devices on Profile Manager
When we use the Profile Manager for our iPad control, we can not select the each iPad to rename them . Is there any way we can rename the devices in Server side? Would you advise us how we can configure in Server side for allowing to rename them?
We use OS X:10.9.5/iOS:8.1/Server:3.2.2You can only rename supervised devices with the profile manager.
All other devices will not show the Rename option at the Devices section.
The users can rename the devices and the new name will be shown after executing "Update Info" at the profile manager. I don't know any other way, with the exception of using the Apple Configurator. -
Profile Manager not starting anymore on Lion
I recently had the bright idea to change my server's hostname and my admin password on the same day (don't ask) and things have been pretty wobbly since then. After going over each entry in the Keychain to change the password, I'm still having some issues with the Profile Manager. I had profiles created under the old hostname (with devices associated to it). I deleted the profiles from my various devices hoping to re-associate them with the new hostname but the Profile Manager won't start anymore, or rather will show as running but really, it timed out.
I know people have been have been having issues with postgres but everything was working fine under the old hostname so I'm not sure that's the same problem. Thanks for the help.
Aug 13 09:51:52 helios servermgrd[90]: servermgr_postgres: waiting for postgres to respond
Aug 13 09:52:30 helios com.apple.devicemanager[16820]: DEBUG: Initializing DeviceManagerDaemon with ports 3320,3321,3322,3323,3324,3325 (physmem = 5GB)
Aug 13 09:52:30 helios com.apple.devicemanager[16820]: DEBUG: Making sure Rails is configured properly
Aug 13 09:52:30 helios com.apple.devicemanager[16820]: DEBUG: Running rake command: /usr/bin/rake db:migrate
Aug 13 09:52:31 helios com.apple.launchd.peruser.70[16834]: Background: Bug: launchd_core_logic.c:3063 (24984):3
Aug 13 09:52:31 helios com.apple.launchd.peruser.70[16834]: Background: job_mig_intran() was confused by PID 16750 UID 70 EUID 70 Mach Port 0x1a07:
Aug 13 09:52:31 helios com.apple.launchd.peruser.70[16834]: Bug: launchd_core_logic.c:8528 (24984):3: j != NULL
Aug 13 09:52:31 helios sandboxd[16830] ([16827]): ruby(16827) deny file-read-metadata /private/var/folders/zz/zyxvpxvq6csfxvn_n00000vm00006x
Aug 13 09:52:32 helios servermgrd[90]: servermgr_devicemgr: response statusCode: 0
Aug 13 09:52:32 helios servermgrd[90]: servermgr_devicemgr: waiting for devicemgr to respond
Aug 13 09:52:34 helios servermgrd[90]: servermgr_devicemgr: response statusCode: 0
Aug 13 09:52:34 helios servermgrd[90]: servermgr_devicemgr: waiting for devicemgr to respond
Aug 13 09:52:34 helios sandboxd[16830] ([16827]): ruby(16827) deny mach-lookup com.apple.distributed_notifications@1v3
Aug 13 09:52:36 helios servermgrd[90]: servermgr_devicemgr: response statusCode: 0
Aug 13 09:52:36 helios servermgrd[90]: servermgr_devicemgr: waiting for devicemgr to respond
Aug 13 09:52:38 helios servermgrd[90]: servermgr_devicemgr: response statusCode: 0
Aug 13 09:52:38 helios servermgrd[90]: servermgr_devicemgr: waiting for devicemgr to respond
Aug 13 09:52:40 helios servermgrd[90]: servermgr_devicemgr: response statusCode: 0
Aug 13 09:52:40 helios servermgrd[90]: servermgr_devicemgr: waiting for devicemgr to respond
Aug 13 09:52:42 helios servermgrd[90]: servermgr_devicemgr: response statusCode: 0
Aug 13 09:52:42 helios servermgrd[90]: servermgr_devicemgr: waiting for devicemgr to respond
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreateDevices (20100225003807)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreateEmailKnobSets (20100226010444)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreateUsers (20100303214947)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreateWebClipKnobSets (20100303223617)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreateRestrictionsKnobSets (20100303223810)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreateLdapKnobSets (20100303223914)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreateCalDavKnobSets (20100303224035)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreateCalSubKnobSets (20100303224314)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreateScepKnobSets (20100303235704)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreateApnKnobSets (20100304000230)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreateExchangeKnobSets (20100304000404)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreateWifiKnobSets (20100304000926)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreateCertificateKnobSets (20100304233616)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreateVpnKnobSets (20100304234049)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreateDockKnobSets (20100305002947)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreateFinderKnobSets (20100305223616)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreateUserGroups (20100317233008)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreateTasks (20100322225845)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreateDataFiles (20100422224508)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreateProfiles (20100510203627)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreateMembersProfiles (20100510220318)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreateKnobSetsProfiles (20100510220334)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreateDeviceGroups (20100510222436)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreateGeneralKnobSets (20100518204147)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreatePasscodeKnobSets (20100518204156)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreateProvisioningProfiles (20100609232301)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreateMcxKnobSets (20100615210803)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreateSettings (20100617233207)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreateEnetAddresses (20100708220118)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreateCardDavKnobSets (20100723165735)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreateIchatKnobSets (20100804174836)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreateDirectoryKnobSets (20100909181713)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreateInterfaceKnobSets (20101022202242)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreateSecurityKnobSets (20101022202251)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreateSessions (20110120211636)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreateSoftwareUpdateKnobSets (20110129135100)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreatePrintingKnobSets (20110129183610)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreateApplicationsKnobSets (20110129183821)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreateMediaAccessKnobSets (20110129183919)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreateMobilityKnobSets (20110129184019)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreateLabSessions (20110131082411)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreatePrinters (20110131153902)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreateSystemApplications (20110132160137)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreateLoginWindowKnobSets (20110202142954)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreateWidgets (20110224125749)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreateLoginItemKnobSets (20110228082620)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreateAutoJoinProfiles (20110299999999)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreateMacRestrictionsKnobSets (20110329155119)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreateEnergySaverKnobSets (20110402120909)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreateParentalControlsKnobSets (20110404133805)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to SettingsAddServerHostname (20110407154640)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to ProfilesAddIsSystemLevel (20110407155130)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to DropApplicationsKnobSets (20110407155300)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to DropMediaAccessKnobSets (20110407155330)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to DevicesAddEthernetmac (20110421100355)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to SettingsAddCodeSignCertRef (20110426131700)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreateCfprefsKnobSets (20110426150013)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to SettingsUpdateCodeSignCertRef (20110428103150)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to InterfacesAddSecurity (20110502140408)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to CreatePrivacyKnobSets (20110506085644)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to SettingsAddIsOdCaRooted (20110512141100)
Aug 13 09:52:44 helios com.apple.devicemanager[16820]: Aug 13 09:52:44 myserver.mydomain.com ProfileManager[16831] <Info>: Migrating to LabSessionAddPendingOdUserGuid (20110520135430)
Aug 13 09:52:44 helios servermgrd[90]: servermgr_devicemgr: response statusCode: 0
Aug 13 09:52:44 helios servermgrd[90]: servermgr_devicemgr: waiting for devicemgr to respond
Aug 13 09:52:45 helios com.apple.devicemanager[16820]: (in /usr/share/devicemgr/backend)
Aug 13 09:52:46 helios servermgrd[90]: servermgr_devicemgr: response statusCode: 0
Aug 13 09:52:46 helios servermgrd[90]: servermgr_devicemgr: waiting for devicemgr to respond
Aug 13 09:52:48 helios servermgrd[90]: servermgr_devicemgr: response statusCode: 0
Aug 13 09:52:48 helios servermgrd[90]: servermgr_devicemgr: waiting for devicemgr to respond
Aug 13 09:52:50 helios servermgrd[90]: servermgr_devicemgr: response statusCode: 0
Aug 13 09:52:50 helios servermgrd[90]: servermgr_devicemgr: waiting for devicemgr to respond
Aug 13 09:52:52 helios servermgrd[90]: servermgr_devicemgr: response statusCode: 0
Aug 13 09:52:52 helios servermgrd[90]: servermgr_devicemgr: waiting for devicemgr to respond
Aug 13 09:52:54 helios servermgrd[90]: servermgr_devicemgr: response statusCode: 0
Aug 13 09:52:54 helios servermgrd[90]: servermgr_devicemgr: waiting for devicemgr to respond
Aug 13 09:52:56 helios servermgrd[90]: servermgr_devicemgr: response statusCode: 0
Aug 13 09:52:56 helios servermgrd[90]: servermgr_devicemgr: waiting for devicemgr to respond
Aug 13 09:52:58 helios servermgrd[90]: servermgr_devicemgr: response statusCode: 0
Aug 13 09:52:58 helios servermgrd[90]: servermgr_devicemgr: waiting for devicemgr to respond
Aug 13 09:53:00 helios servermgrd[90]: servermgr_devicemgr: response statusCode: 0
Aug 13 09:53:00 helios servermgrd[90]: servermgr_devicemgr: waiting for devicemgr to respond
Aug 13 09:53:02 helios servermgrd[90]: servermgr_devicemgr: Timed out trying to confirm devicemgr is responding.Try this in Terminal.app:
cd /etc/apache2/sites
sudo -s # become admin--you will have to enter your password here
rm 0000_any_443_.conf
cp 0000_any_80_.conf.default 0000_any_80_.conf
cp virtual_host_global.conf.default virtual_host_global.conf
exit # go back to being a normal user
Then go back to Server.app and restart your services. -
Profile Manager not working at all, psql cannot connect to server??
Upgraded existing system to Mavericks. Everything was running fine with Mountain Lion, everything fine on my test server too. After upgrade to Server 3.0, Profile Manager does not work. It cannot be configured.
After reading through posts here and trying their suggestions I find that psql cannot connect to the server and get this error at every turn.
psql: could not connect to server: No such file or directory
Is the server running locally and accepting
connections on Unix domain socket "/Library/Server/ProfileManager/Config/var/PostgreSQL/.s.PGSQL.5432"?
Activity monitor shows it's running, also checked network utility to make sure I could get a connection through 127.0.0.1 on port 5432. It's good too.
Also in the migration_tool.log file the last entry backs up this error.
STDERR | psql: could not connect to server: No such file or directory
| Is the server running locally and accepting
| connections on Unix domain socket "/Library/Server/ProfileManager/Config/var/PostgreSQL/.s.PGSQL.5432"?
Where do I start? I think getting psql working is a big first step....Thanks Tim,
I manage several different systems so I started comparing the one that doesn't work to one that does work.
On the one that's malfunctioning, this is a message I see often:
Is the server running locally and accepting
connections on Unix domain socket "/Library/Server/ProfileManager/Config/var/PostgreSQL/.s.PGSQL.5432"?
So I checked to see what's in the directory /Library/Server/ProfileManager/Config/var/PostgreSQL/ and got this result.
sudo ls -la /Library/Server/ProfileManager/Config/var/PostgreSQL/
total 0
drwxr-xr-x 2 _devicemgr _devicemgr 68 Dec 4 09:31 .
drwxr-xr-x 3 _devicemgr _devicemgr 102 Nov 13 06:13 ..
An Obviously empty directory.
Now on the server that's working this is what I get.
sudo ls -la /Library/Server/ProfileManager/Config/var/PostgreSQL/
Password:
total 16
drwxr-xr-x 6 _devicemgr _devicemgr 204 Nov 22 17:47 .
drwxr-xr-x 8 _devicemgr _devicemgr 272 Nov 22 17:48 ..
srwxrwx--- 1 _devicemgr _devicemgr 0 Dec 4 09:20 .s.PGSQL.5432
-rw------- 1 _devicemgr _devicemgr 139 Dec 4 09:20 .s.PGSQL.5432.lock
srw-rw-rw- 1 _devicemgr _devicemgr 0 Nov 22 17:47 .xpg.skt
lrwxr-xr-x 1 _devicemgr _devicemgr 3 Nov 22 17:47 .xpg.skt.lock -> 164
Obviously something is missing on the one that's malfunctioning.
I think that pgsql isn't running correctly and like you said Apple moved some things and we don't know where all of them went.
Any suggestions anybody? -
Error enrolling devices in profile manager!!
I have enrolling my macbook to the profile manager.
When I go to the https://(FQDN)/mydevices/ , and I hit the enroll buttom after logining in, and download the config file, try to install.. I get an error that says:
"The profile is either missing some required information, or contains information in an invalid format."
The problem is that I managed to enroll my iPhone with no problems.. only my mac (which is running the server OS) is not enrolling.
the certificate is valid from a trusted commercial thing..
Can someone please help?only my mac (which is running the server OS) is not enrolling.
Why are you trying to enroll your device management server in it's own device management?
I've never tested anything like that, but I bet you can't do that... -
Cannot enroll iOS 7 devices in Profile Manager
Hi All,
I had some new employees start today who had already updated to the iOS 7 GM and we're having issues enrolling them into profile manager, which we use for all contacts, email, wifi configuration.
I noticed there was a server update to OS Server 2.2.2 (running on Mac OS X 10.8.5), and ran that already, rebooted and restarted all the services.
When a user on an iOS 7 device visits https://server.com/mydevices and hits the "enroll" option, the profile downloads, opens sytem settings as would be expected, prompts for the 4 digit passcode and then fails to install stating "This iphone/iPad is not activated".
Thinking this may have been a developer device, I updated one of our units using the release that happened a few hours ago. Again when I try to enroll I get the same error. I've also tried loading the enrollment profile to the device using Configurator, but no luck.
I've also added UDID based placeholders in profile manager, and no luck.
Anyone have any suggestions?
Thanks!I was also having the same issue. Fortunately it has only been one device so far. Here is what I did...
1. I updated the server to 10.8.5
2. I updated Server to the newest version (2.2.2)
3. I restored the device using iTunes to a default state.
4. At this point I was able to get the Enroll button and enroll the device.
Now I am running into an issue with it not pushing the settings to the device. But I am testing some things to see what I can figure out. All of my other devices are working just fine.
Maybe you are looking for
-
Pattern and Matcher of Regular Expressions
Hello All, MTMISRVLGLIRDQAISTTFGANAVTDAFWVAFRIPNFLRRLFAEGSFATAFVPVFTEVK ETRPHADLRELMARVSGTLGGMLLLITALGLIFTPQLAAVFSDGAATNPEKYGLLVDLLR LTFPFLLFVSLTALAGGALNSFQRFAIPALTPVILNLCMIAGALWLAPRLEVPILALGWA VLVAGALQLLFQLPALKGIDLLTLPRWGWNHPDVRKVLTLMIPTLFGSSIAQINLM
-
I am writing to you with a HUGE disappointment. I am an Executive Agent for Nationwide Insurance. I purchased the Blackberry 8330 thinking I had a wonderful phone! My service is through Boost mobile. When I got this phone, it errored out all the time
-
ORA-01562 in undo_management=AUTO mode
Hi, Please , is it normal that a database has an ORA-01562 error although it has an undo_management init parameter value equal to AUTO? My database is 10g , I have an an undo_management init parameter value equal to AUTO, but when I try to do an inse
-
Hi I'm about to recover an instance from an Rman backup where only the backup file itself is available. Since nobody alive seems to know what Ora version the original DB was from I need to have at least 9i and 8i available for installation so I can m
-
6 hours exporting? Ridiculus.
Hey everyone, Im in the engineering world and Im used to makeing powerpoint presentations. But I desided to do my final presentation on a project on Keynote do to its estetics. My presentation has 20 slides, and 1 6 minute video, I exported it into a