MATCH COUNT Regular expression

Hello,
does anybody know why these statements return mcount = 1 and not mcount = 4???
FIND 'a' IN 'aabaa' MATCH COUNT mcount.
FIND REGEX 'a+' IN 'aabaa' MATCH COUNT mcount.
Thank you
Manuel

Try adding option "ALL OCCURRENCES" to yur example.
Best!
Jim

Similar Messages

Pattern matching using Regular expression

Hi,
I am working on pattern matching using regular expression. I the table, I have 2 columns A and B
A has value 'A499BPAU4A32A386KBCZ4C13C41D20E'
B has value like '*CZ4*M11*7NQ+RDR+RSM-R9A-R9B'
the requirement is that I have to match the columns of B in A. If there is a value with * sign, this must be present in A like 'CZ4' should exit in string A.
The issue I am facing is that there are 2 values with * sign. The code works fine for first match (CZ4) but it does not look further as M11 does not exist in A.
I used the condition
AND instr(A,substr(REGEXP_SUBSTR(B, '*[^*]{3}'),2) ,1)=0
First of all, is this possible to match multiple patterns in one condition?
If yes, please suggest.
Thanks

user2544469 wrote:
Thanks a lot Frank. This query worked wonderful for the test data I have provided however I have some concerns:
- query doesnot include the column BOOK which is a mandatory check.Sorry, that was my mistake. It was a very easy mistake to make, since you posted sample data where it didn't matter. Instead of doing a cross-join between vn and got_must_have_cnt, do an inner join, using book. That means book will have to be in got_must_have_cnt, and all the sub-queries from which it descends. Look for comments that say "March 22".
If you want to treat '+' in test_cat.codes as '*', then the simplest thing is probably just to use REPLACE, so that when the table has '+', you use '*' instead.
WITH     got_token_cnt     AS
     SELECT     cat
     ,     book                                        -- Added March 22
     ,     REPLACE (codes, '+', '*') AS codes                    -- If desired. Changed March 22
     ,     LENGTH (codes) - LENGTH ( TRANSLATE ( codes
                                                   , 'x*+-'
                                  , 'x'
                         ) AS token_cnt
     FROM    test_cat
,     cntr     AS
     SELECT     LEVEL     AS n
     FROM     ( SELECT MAX (token_cnt)     AS max_token_cnt
             FROM        got_token_cnt
     CONNECT BY     LEVEL     <= max_token_cnt
,     got_tokens     AS
     SELECT     t.cat
     ,     t.book                                        -- Added March 22
     ,     REGEXP_SUBSTR ( t.codes
                     , '[*+-]'
                     , 1
                     , c.n
                     )          AS token_type
     ,     SUBSTR ( REGEXP_SUBSTR ( t.codes
                                   , '[*+-][^*+-]*'
                           , 1
                           , c.n
               , 2
               )          AS token
     FROM     got_token_cnt     t
     JOIN     cntr          c ON     c.n     <= t.token_cnt
,     got_must_have_cnt     AS
     SELECT       cat, book                                   -- Changed March 22
     ,       COUNT (CASE WHEN token_type = '*' THEN 1 END) AS must_have_cnt
     FROM       got_tokens
     GROUP BY cat, book                                   -- Changed March 22
SELECT       mh.cat
,       vn.vn_no
FROM       got_must_have_cnt     mh
JOIN                    vn ON mh.book     = vn.book               -- Changed March 22
LEFT OUTER JOIN      got_tokens     gt ON     mh.cat                  = gt.cat
                                 AND INSTR (vn.codes, gt.token) > 1
GROUP BY mh.cat
,            mh.must_have_cnt
,            vn.vn_no
HAVING       COUNT (CASE WHEN gt.token_type = '*' THEN 1 END)     = mh.must_have_cnt
AND       COUNT (CASE WHEN gt.token_type = '-' THEN 1 END)     = 0
ORDER BY mh.cat
- query is very slow with 60000 records in vn table. Cost is somewhere around 36000.See these threads:
When your query takes too long ...
HOW TO: Post a SQL statement tuning request - template posting
Relational databases were designed to have (at most) one piece of information in each column. If you decide to have multiple items in the same column (as you have a variable number of tokens in the codes column), don't be surprised if that makes things slower and more complicated. Most of the query I posted, and perhaps most of the time needed, is jsut to normalize the data. If you stored the data in a narmalized form, perhaps something like got_tokens, then you wouldn't need the first 3 sub-queries that I posted.
Edited by: Frank Kulash on Mar 22, 2011 12:04 PM

Matches from regular expression into collection

Hello,
I need to do the following:
I have a long string with some similar repeated data. I would like, using a regular expression, to extracts all matches in a collection. Is there a way of performing this task?
I have look through the owa_pattern package, but as far as I found out, I can extract only a simple match. Here is an exact quote:
"If multiple overlapping strings can match the regular expression, this function takes the longest match. " - http://download.oracle.com/docs/cd/B28359_01/appdev.111/b28419/w_patt.htm
So what can I do if I want to get all the matches?
Thank you in anticipation. Any help would be appreciated.
Best regards,
beroetz

I think your need a tokenizer-function.
If the string +:in_str+ is delimited by +:in_delimiter+ you could try this:
SELECT REGEXP_REPLACE(REGEXP_SUBSTR( :in_str || :in_delimiter, '(.*?)' || :in_delimiter, 1, LEVEL ), :in_delimiter, '') TOKEN
BULK COLLECT INTO :my_nested_table
FROM DUAL
CONNECT BY REGEXP_INSTR( :in_str || :in_delimiter, '(.*?)' || :in_delimiter, 1, LEVEL ) > 0
ORDER BY LEVEL ASC;
I wrote a string-to-textarray-tokenizer (and it's pendant) some times ago, being able to cut from certain positions within the string using regular expressions and return the elements into an nested table of varchar2. It looks like:
TYPE pos_arraytype IS TABLE OF POSITIVE ;
TYPE text_arraytype IS TABLE OF VARCHAR2(2000);
FUNCTION stringToTextarray(in_str IN VARCHAR2, in_pos_arr IN pos_arraytype, in_regexp_arr IN text_arraytype DEFAULT NULL, in_trim_strings IN BOOLEAN DEFAULT TRUE)
RETURN text_arraytype ;
in_str is the string to be tokenized
in_pos_arr is a table of positive values of positions in the string to be cut
in_regexp_arr is a table of regular expressions to use at each position declared by in_pos_arr
in_trim_strings is a flag, if the cutted element should be trimmed
using above for example:
in_str = 'Markus van Muster 347651234XY Musterdaam ABCDE'
in_pos_arr = (1, 13, 35, 35, 42)
in_regexp_arr = ('(.?){12}', '([^[:digit:]]?){22}', '[[:digit:]]{4}', '[[:alpha:]]{2}', '(.?){14}')
in_trim_strings = TRUE
RETURN collection ('Markus','van Muster','1234','XY','Musterdaam')
If you need the code, then tell me! I'm looking for....
Cheers,
Martin
Edited by: Nuerni on 17.10.2008 08:49

XML node name matching with regular expressions

Hello,
If i have an xml file that has the following:
     <parameter>
          <name>M2-WIDTH</name>
          <value column="09" date="2004-10-31T19:56:30" row="03" waferID="PUK444150-20">10.4518</value>
     </parameter>
     <parameter>
          <name>M2-GAP</name>
          <value column="29" date="2004-10-31T19:56:30" row="06" waferID="PUK444150-03">2.864</value>
     </parameter>
     <parameter>
          <name>RES-LENGTH</name>
          <value column="29" date="2004-10-31T19:56:30" row="06" waferID="PUK444150-03">2.864</value>
     </parameter>
Is there anyway i can get a list of nodes that match a certain pattern say where name=M2* ?
I cant seem to find any information where i can match a regular expression. I see how you can do:
String expression=/parameter[@name='M2-LENG']/value/text()";
NodeList nodes = (NodeList) xPath.evaluate(expression, inputSource, XPathConstants.NODESET);
But i want to be able to say:
String expression=/parameter[@name='M2-*']/value/text()";
Is this possible? if so how can i do this?
Thanks!

As implemented in Java, XPath does not support regular expressions, but in most cases there are workarounds thanks to XPath functions. Correct me if I'm wrong, but setting your expression against the XML document (i.e. because there are no "name" attributes in the whole document) I think you mean to get the value of the <value> elements that have a <parameter> parent element and a <name> sibling element whose value starts with "M2-". If that is the case, you can use the following query expression:String expression = "//parameter/value[substring(../name,1,3)='M2-']";Sorry if I misunderstood the meaning of your expression, but I hope this will help you get the hang of using XPath functions as a substitute for regular expressions.

Pattern and Matcher of Regular Expressions

Hello All,
MTMISRVLGLIRDQAISTTFGANAVTDAFWVAFRIPNFLRRLFAEGSFATAFVPVFTEVK
ETRPHADLRELMARVSGTLGGMLLLITALGLIFTPQLAAVFSDGAATNPEKYGLLVDLLR
LTFPFLLFVSLTALAGGALNSFQRFAIPALTPVILNLCMIAGALWLAPRLEVPILALGWA
VLVAGALQLLFQLPALKGIDLLTLPRWGWNHPDVRKVLTLMIPTLFGSSIAQINLMLDTV
IAARLADGSQSWLSLADRFLELPLGVFGVALGTVILPALARHHVKTDRSAFSGALDWGFR
TTLLIAMPAMLGLLLLAEPLVATLFQYRQFTAFDTRMTAMSVYGLSFGLPAYAMLKVLLP
I need some help with the regular expressions in java.
I have encountered a problem on how to retrieve two strings with Pattern and Matcher.
I have written this code to match one substring"MTMISRVLGLIRDQ", but I want to match multiple substrings in a string.
Pattern findstring = Pattern.compile("MTMISRVLGLIRDQ");
Matcher m = findstring.matcher(S);
while (m.find())
outputStream.println("Selected Sequence \"" + m.group() +
"\" starting at index " + m.start() +
" and ending at index " m.end() ".");
Any help would be appreciated.

Double post: http://forum.java.sun.com/thread.jspa?threadID=726158&tstart=0

String.matches() question - regular expression help

How come the following code's if condition returns false?
String someFile="Dr. Phil.pdf";
if (someFile.matches("[.][Pp][Dd][Ff]$")) {
System.out.println("File is a pdf file.");
}When I change the the matches method to matches(".*[Pp][Dd][Ff]$") it works, so does that mean it has to match the entire string to return true? If so, how can I determine if a partial match occured?
If partial matching isn't feasible, then can someone help me look determine if this is the best matching pattern to use:
matches(".*[.][Pp][Dd][Ff]$")Thanks.

The documentation is your friend.
[String.matches(regex)|http://java.sun.com/javase/6/docs/api/java/lang/String.html#matches(java.lang.String)] says:
An invocation of this method of the form str.matches(regex) yields exactly the same result as the expression
Pattern.matches(regex, str)And [Pattern.matches(regex, str)|http://java.sun.com/javase/6/docs/api/java/util/regex/Pattern.html#matches(java.lang.String, java.lang.CharSequence)] says
behaves in exactly the same way as the expression
Pattern.compile(regex).matcher(input).matches()And [Matcher.matches()|http://java.sun.com/javase/6/docs/api/java/util/regex/Matcher.html#matches()] says
Attempts to match the entire region against the pattern.

REGEX: question about finding Overlapping matches using regular expressions

I have the following problem.
Say for my pattern I use:
Pattern pattern = Pattern.compile("AAA");
Matcher matcher = pattern.matcher("AAAAAA");when I run a loop
while (matcher.find())
System.out.println("Match Found: "+matcher.start()+" "+matcher.end());I get 2 Hits shown in the following output:
Match Found: 0 3
Match Found: 3 6
therefore the regex is seeing the first AAA then the second AAA.
I want it to find the other AAA's in there that are overlapping the other two finds i.e. I want the output to find
AAA from 0 to 3
AAA from 1 to 4
AAA from 2 to 5 and finally
AAA from 3 to 6
thereby including the overlapping finds.
How can I do this using regex? what am I missing that prevents the overlapping matches to be found? Do I need a quantifier?
Thanks for the help!

While the solutions above work fine with the given input, they don't really find all overlapping matches. They just find the longest possible match at each start position. Here's a more thorough approach:import java.util.*;
import java.util.regex.*;
public class Test
public static List<String> matchAllWays(String rgx, String str)
    Pattern p = Pattern.compile(rgx);
    Matcher m = p.matcher(str);
    List<String> result = new ArrayList<String>();
    int len = str.length();
    int start = 0;
    int end = len;
    while (start < len && m.region(start, len).find())
      start = m.start();
      do
        result.add(m.group());
        end = m.end() - 1;
      } while (end > start && m.region(start, end).find());
      start++;
    return result;
public static void main(String[] args)
    List<String> matches = matchAllWays("a.*a", "abracadabra");
    System.out.println(matches);
}This approach requires JDK 1.5 or later; that's when the regions API was added to Matcher.

Cannot get regular expression to return true in String.matches()

Hi,
My String that I'm attempting to match a regular expression against is: value=='ORIG')
My regular expression is: value=='ORIG'\\) The double backslashes are included as a delimiter for ')' which is a regular expression special character
However, when I call the String.matches() method for this regular expression it returns false. Where am I going wrong?
Thanks.

The string doesn't contain what you think it contains, or you made a mistake in your implementation.
public class Bar {
   public static void main(final String... args) {
      final String s = "value=='ORIG')";
      System.out.println(s.matches("value=='ORIG'\\)")); // Prints "true"
}

Regular Expressions and Collections

Is it possible to use refular expressions when validating collection items?
I have a loop that checks collection values for null, not null etc. I would also like to validate the format of some text fields in the same collection loop.
i.e.
for i in 1..htmldb_application.g_f02.count
loop
if
replace(htmldb_application.g_f07(i), 'NULL',NULL) is null
and TO_NUMBER(NVL(htmldb_application.g_f02(i), 0)) > 0
THEN
return 'A Demand Quantity Value Must Be Specified.';
elsif
-- check htmldb_application.g_f07(i) is correctly formatted using Reg Expressions
then
return 'Reg Expression error text goes here';
end if;
end loop;
Regards
Duncan

Well, the obvious answer is "only write the data to the database if the input doesn't match the regular expression."
Presumably you're really asking how to do that - but it depends upon how your application is structured in the first place, and you haven't told us anything at all about that.

How to find sunstring with regular expression?

How can I find a substring in a string with a regular expression?
Example:
I have a original string "<tr><th>RecordId: </th><td valign=middle>A4711</td></tr>"
Now i want to extract the value "A4711" from this string with a regular expression. Everything except "A4711" is fixed, the id "A4711" itself is dynamic. How is it possible to get the substring "A4711" of the original string with a regular expression?

i wrote a little method with the infos above to get such results:
     * Get all substrings of a string that matches a regular expression.
     * @param original String to inspect.
     * @param regExp Regular expression as search criteria.
     * @return All matches of <i>regExp</i> or null if one input parameter is null.
    public static String[] getSubstrings(String original, String regExp) {
        String[] result = null;
        if (original != null && regExp != null) {
            Pattern pattern = Pattern.compile(regExp);
            Matcher matcher = pattern.matcher(original);
            boolean matchFound = matcher.find();
            Vector matches = new Vector();
            while (matchFound) {
                String match = matcher.group();
                matches.addElement(match);
                matchFound = matcher.find();
            }//next match
            int count = matches.size();
            result = new String[count];
            for (int i = 0; i < count; i++) {
                result[i] = (String) matches.elementAt(i);
            }//next match
        }//else: input unavailable
        return result;
    }//getSubstrings()

Help with Regular Expression for field validation

I'm fairly new to using regular expressions and using Acrobat. This is probably a simple question, but I've been unable to figure it out.
I have a text field on a PDF that I would like to be 9 characters in length. The first 2 characters can only be alphanumeric, the last 7 characters can only be numeric.
At first I was using the following, which allows all the characters to be alphanumeric:
var re = /^[A-Za-z0-9 :\\_]$/;
if (event.change.length >0) {
if (event.willCommit == false) {
    if (!re.test(event.change)) {
        event.rc = false
That works fine, but it's not quite what I needed. With some assistance I changed it (see below) to fit what I was looking for. However, this didn't work; it prevents anything from being entered in the field:
var re = /^[A-Za-z0-9]{2}\d{7}$/;
if (event.change.length >0) {
if (event.willCommit == false) {
    if (!re.test(event.change)) {
        event.rc = false
Any help would be greatly appreciated.
Thanks...

Here's a function you can call form the field's custom Format script. It should be placed in a document-level JavaScript:
function custom_ks1() {
    // Define non-commited regular expression
    var re = /^[A-Za-z0-9]{0,2}([0-9]{0,7})?$/;
    // Get all of the characters the user has entered
    var value = AFMergeChange(event);
    // Allow field to be cleared
    if(!value) return;
    if (event.willCommit) {
        // Define commited regular expression
        var re = /^[A-Za-z0-9]{2}[0-9]{7}$/;
        if (!re.test(value)) { // If final value doesn't match, alert user
            app.alert("Your error message goes here.");
            // event.rc = false
    } else { // not commited
        // Only allow characters that match the regular expression
        event.rc = re.test(value);
Call it like this:
// Custom Keystroke script
custom1_ks();

Java – Regular Expressions – Finding any non digit byte in a multiple byte

Hello,
I’m new to JAVA and Regular Expressions; I’m trying to write a regular expression that will find any records that contain a non digit byte in a multiple byte field.
I thought the following was the correct expression but it is only finding records that contain “all” non digit bytes.
\D{1,}
\D = Non Digit
{1,} = at least 1 or more
Below is my sample data. I would like the regular expression to find all of the records that are not all numeric. However when I use the regular expression \D{1,} it is only finding the 2 records that all bytes are non digits. (i.e. “ “ and “A “)
“ 111229”
“2 111229”
“20091229”
“200912c9”
“201#1229”
“20101229”
“20110229”
“20111*29”
“20111029”
“20111229”
“20B11229”
“A “
“A0111229”
Please note I have also tried \D{1,}+ and \D{1,}? And they also do not return my desired results
Any assistance someone can provide would be greatly appreciated.

You don't show the code you are using but I surmise you are using String.matches() which requires that the whole target must match the regular expression not just part of it. Instead you should create a Pattern and then a Matcher and use the Matcher.find() method. Check the Javadoc for Pattern and Matcher and look at the Java regex tutorial - http://docs.oracle.com/javase/tutorial/essential/regex/ .
P.S. You can re-use the Pattern object - you don't have to create it every time you need one.
P.P.S. Java regular expressions work with characters not bytes and characters are not not not bytes.

Regular expressions and sql

I have working regular expressions and a working sql connection, but I don�t know how to stop the info from getting into the database when input doesent match the regular expression.
For instans, you put in an e-mail without an "@" and my program writes and error message. But the info still gets in to the database.
Any help would be much apreciated as I dont know where to start. If you have links or code examples that would be great to.
Thanx.

Well, the obvious answer is "only write the data to the database if the input doesn't match the regular expression."
Presumably you're really asking how to do that - but it depends upon how your application is structured in the first place, and you haven't told us anything at all about that.

Regular expressions and backreference

Hello!
I am trying to use backreferences in REGEXP in the PERL-style, where I want to match my regular expression and later refer to the grouped values. I can read that those are referecenced with \1 .. \9, but I simply cant get it to work. Here is an example in PL/SQL:
SELECT REGEXP_SUBSTR(l_users.adresse,'([A-Z]+)\s+(\d+)')
INTO l_dummy_varchar2
FROM dual;
OR I could do things like:
l_dummy_varchar2 := REGEXP_SUBSTR(l_users.adresse,'([A-Z]+)\s+(\d+)');
It seems to work, but I cant figure out how to get the backreferenced value.
I would love to do things like:
dbms_output.put_line('my value ='||\1)
but this doesnt work.
Help is very much appreciated.
Best regards
Dannie

Likewise you can extract things using the
REGEXP_SUBSTR, but you don't need back
referencing...backreferencing is better than additional function (ltrim) use, and BTW be careful with this "ltrims":
SQL> set serveroutput on
SQL>
SQL> DECLARE
2       v_txt VARCHAR2(100);
3     BEGIN
4       v_txt := ltrim(regexp_substr('HERE IS AN ASCII CHARACTER', 'IS AN [[:alnum:]]*'),'IS AN ');
5       DBMS_OUTPUT.PUT_LINE('Word after IS AN: '||v_txt);
6 END;
7 /
Word after IS AN: CII
PL/SQL procedure successfully completed
SQL>
SQL> DECLARE
2       v_txt VARCHAR2(100);
3     BEGIN
4       v_txt := regexp_replace('HERE IS AN ASCII CHARACTER', 'IS AN ([[:alnum:]]*)|.','\1');
5       DBMS_OUTPUT.PUT_LINE('Word after IS AN: '||v_txt);
6 END;
7 /
Word after IS AN: ASCII
PL/SQL procedure successfully completed
SQL> -----------
VB
http://volder-notes.blogspot.com/

Regular expressions... they are not regular! =)

So,
I've been pulling my hair out with regular expressions. I'm sure there is a logical explanation to this, but i've read a bunch of explanations and i THOUGHT i understood this, but i don't. Here goes:
I have a string "2010PETE". I tried matching it to "\\d{1,}" (this is how i entered it in Java). This returns FALSE. HOWEVER, it seems to me the above should be TRUE because it says that a greedy quantifier with {1,} searches for the the preceding character AT LEAST N times, where in this case n=1, so i interpret this as "If a digit (\\d) is found at least once within the string, then this string matches the regular expression. This does NOT seem to be the case.
Can someone clear this up for me?

THANK YOU. i think that is what i was missing, the part about
"would only match if the input consisted of at least one digit, possibly multiple digits, and nothing else."
I read the documentation and some of it didn't seem to be clear on that point.
i'll play around with this and see how far i can get. if i still have questions i will post some code for sure, and try to get a nice, rounded set of examples.
thanks!
ONE OTHER QUESTION I JUST THOUGHT OF: does the .matches() method match expressions when some substring of the String matches, or does it have to match the entire String? So, if i have the String "123ABC", and i ask to match "1 or more letters" will it fail because there are non-letters in the String, but then pass if i add "1 or more letters AND 1 or more digits"? so, in the latter every character in the String is accounted for in the search, as opposed to the first. Is that correct, or are there ways to JUST match some substring in the String instead of the whole thing? i WILL make some examples too... but does that make sense?
Edited by: pedron on Jan 12, 2012 3:23 PM

MATCH COUNT Regular expression

Similar Messages

Maybe you are looking for