PCTFREE setting for index in Oracle 10g R2

Is PCTFREE parameter obsolete in oracle 10g R2? I don't see any reference to this paramerer in oracle documentation:
http://download.oracle.com/docs/cd/B19306_01/server.102/b14231.pdf
But 10g R 1 does mention about this setting.
http://support.cs.nott.ac.uk/help/docs/databases/oracle/standard/server.101/b10739.pdf
We are still using Dictionary Managed tablespaces on 10.2.0.3. Can we ignore this parameter on 10g R2 ?
Thank You

PCTFREE is still relevent even in ASSM. (that you are using DMT means that you are not using ASSM, but LMT could be MSSM !)
I couldn't find PCTFREE in the Administrator's Guide but it is still very much present in the SQL Reference
http://download.oracle.com/docs/cd/B19306_01/server.102/b14200/clauses007.htm#g1058547
and a couple of references in the Performance Tuning Guide.

Similar Messages

Can cold backup be taken for ASM managed oracle 10g databases

Can cold backup be taken for ASM managed oracle 10g databases
Pls help

do we still need to take cold backupYou need to take backup. Hot or cold depends on how your DB is running (archivelog or not).
Will we have file permisions for copyng Use RMAN and don't worry about that.

Problems using Quick Migrate in SQL Developer 1.5 for MySQL to Oracle 10g

Hi all,
I am trying to use SQL Developer 1.5 migration tools (Quick Migrate) to perform online capture and build source model to migrate from MySQL 5.x to Oracle 10g on Windows platform. I get these errors and the Quick Migrate process fails:
oracle.dbtools.metadata.persistence.PersistableObject.doInsert(PersistableObject.java:238)
I did a search and used the sqldeveloper.cmd script but still fails. Then I created a new database and truncated the repository. I now get the above error plus two new ones listed below:
oracle.jdbc.driver.DatabaseError.throwSqlException(DatabaseError.java:112)
Error loading nls:OALL8 is in an inconsistent state
Error occurred during capture: Protocol violation
It fails during the capture process for MySQL 5.1 database
when it begins to capture the tables from MySQL.
Does anyone know how to resolve these issues when migrating from MySQL to Oracle 10g using Quick Migrate with SQL Developer 1.5 release?
Regards,
Ben Prusinski
Message was edited by:
benprusinski
Message was edited by:
benprusinski

Hi all,
I put the following in my sqldeveloper.cmd file:
SET ORACLE_HOME=%CD%
What is very confusing is that with SQL Developer 1.5, there are several levels and several SQL Developer executables! I am really not sure which of these to use:
I created the SQLDeveloper 1.5 directory called SQLDeveloper1_5 on Windows:
1) cd C:\sqldeveloper1_5\sqldeveloper-5338
there exists a sqldeveloper.exe
2) cd c:\sqldeveloper1_5\sqldeveloper-5338\sqldeveloper\sqldeveloper.exe
3) cd c:\sqldeveloper1_5\sqldeveloper-5338\sqldeveloper\sqldeveloer\bin\sqldeveloper.exe
Which SQLDeveloper 1.5 executable should I be using and where should I place the
sqldeveloper.cmd file?
Also I did try to use a different database and schema for the repository with Quick Migrate but it appears a bug exists in SQL Developer 1.5 version that causes errors with Quick Migrate for MySQL to Oracle? Is this correct?
As an update, I ran the following commands:
cd to
c:\sqldeveloper1_5\sqldeveloper-5338\sqldeveloper\sqldeveloper\bin
sqldeveloper.cmd sqldeveloper.exe
Start sqldeveloper.exe
Perform standard capture for MySQL using the new mig2 schema as the new repository
It starts the capture but fails on the errors below:
Error loading nls:OALL8 is in an inconsistent state
UPDATE
============================
I tried this again and it worked with the exception of one error message listed below:
Here are the steps that I followed:
1. Create a Windows cmd script
Put the following entries in the script:
SET ORACLE_HOME=%CD%
save the command windows script as sqldeveloper.cmd
Copy this script to the base installation directory for SQLDeveloper
Example:
1. cd c:\SQLDeveloper1_5\sqldeveloper-5338\sqldeveloper
2. Start SQLDeveloper with the command script that you created earlier
Example:
Open a Windows shell prompt window and execute the following scripts:
a) sqldeveloper.cmd sqldeveloper.exe
b) sqldeveloper.exe
3) In SQL Developer 1.5
From the Migrate menu,
a) Delete current repository and create a new schema in Oracle target database call it mig2.
b) Then create a new repository in SQL Developer 1.5
c) Right mouse click on the MySQL 5.x database and choose capture
It worked with the exception of one error message:
o.jdbc.driver.OracleDriver
Error while registering Oracle JDBC Diagnosability MBean.
So it looks like something is screwed up with my JDBC drivers and configuration for MySQL. How do I diagnose the JDBC driver issue for MySQL?
Thanks!!!
Ben
Thanks
Ben

Setting Password Policy in Oracle 10g

Hi,
Could you guide me please? Up to date there has not been a Policy for passwords in our 10g Database which means the user can set anything for their password. We however now require to implement a Password Policy and would appreciate some guidance in doing this.
We don't use Enterprise Manager,we have chosen not to configure it on our system.
These are the steps I propose to take to set the password policy:
1. Edit $ORACLE_HOME/rdbms/admin/utlpwdmg.sql to change default profile values to desired values.
2. as SYS run utlpwdmg.sql
Is this correct? Is there anything else I should do?
thank you.

user8869798 wrote:
Hi,
I had a look at dba_profiles:
DEFAULT PASSWORD_VERIFY_FUNCTION PASSWORD NULL
This suggests that the default profile is not using the function. It doesn't "suggest" it. That's exactly what it means. The default profile is not using a password verify function.
In the light of this, is it safe then to edit the function and the default profile will be unaffected? The profile cannot be affected by a change to a function that it does not reference.
I don't want to change the default profile. I plan to create another profile that will make use of the function and then apply it for the users
thanksthen proceed to do so. Why would you not want the function to be 'default' -- referenced by the default profile?
BTW, you can name that function anything you want. When you assign a password complexity function to a profile, you assign it by the name of the function. So you are not limited to the name used by the 'out of the box' script provided by oracle. You might want to name your own function something like MYCORP_PSWD_POLICY. And of course the name of the sql file where you keep the code can also be named anything you like, so you might want to name it accordingly. Just so you have a clear seperateion between your company's stuff and that provided by Oracle.

Optimizer_mode set to CHOOSE in Oracle 10G

I a bit confused about the new settings for the parameter "optimizer_mode" on 10G. If the parameter is set to CHOOSE on a 10G database, what value is the database actually using since CHOOSE is no longer a valid choice for this parameter (ALL_ROWS or FIRST_ROWS) ?
Thanks
John

database actually using since CHOOSE is no longer a
valid choice for this parameter (ALL_ROWS or
FIRST_ROWS) ?It is completely valid choice. It is deprecated yes and should not be used but see as follows:
Connected to:
Oracle Database 10g Enterprise Edition Release 10.2.0.1.0 - Production
With the Partitioning, OLAP and Data Mining options
SQL> alter system set optimizer_mode = choose scope=both;
System altered.
SQL> select user from dual;
USER
GINTS
SQL> create table bzzz as select * from dba_source;
Table created.
SQL> alter session set optimizer_dynamic_sampling = 0;
Session altered.
SQL> set autot on
SQL> select count(*) from bzzz;
COUNT(*)
    280779
Execution Plan
Plan hash value: 2985757553
| Id | Operation          | Name |
|   0 | SELECT STATEMENT   |      |
|   1 | SORT AGGREGATE    |      |
|   2 |   TABLE ACCESS FULL| BZZZ |
Note
   - rule based optimizer used (consider using cbo)Gints Plivna
http://www.gplivna.eu

Can I disable logging for session in Oracle 10g?

I use a procedure to delete a lot of row for an application repeatedly. Because the DELETE statement is time consuming and the data don't need to be archived, I decide to use the nologging option.
How to do it?
What is the best choice? Can I disable logging from session in Oracle 10g?
Thank you
Edited by: jetq on Jul 23, 2009 9:46 AM

Hi,
"Delete" without generating redo-log is not possible.
If you are on 10g, one way of making this thing efficiant is partition the table, with range-list partitioning. Partitioning existing table will be an excercise in itself, but that will be one time activity.
In partitioned (or sub-partitioned) tables, you can truncate a partition (or subpartition). That won't generate any redo log (or very very less redo log) and that runs in seconds.
In your case if you range partition INCOMING table by datetime (1 partition per day) and list sub-partition it by STATUS, that would help.
Another approach is, if you are deleteing, say 80% records every day and leaving 20% (or very less) records. What you can do is, partition the table only by range on datetime. Then, every time you want to delete data, copy the rows you want to keep in some other table (or temporary table), truncate partition for that day and insert rows back (which you want to keep).
I have done a similar thing and it works very quickly and generates very less redo log. Redo log generated in case of truncating partition or creating new partitions is just for Oracle internal commands (like data dictionary update etc).
Have fun.

Setting of ICONS in Oracle 10G Application Server

Hi...
I'm facing a problem of Icons which are not displayed at run time.
I'm using Oracle 10G Application Server.
plz tell what setting should i do.
its urgent.
Thanks & Regards
Sanjeev Kumar

1 did u put the icon file in the forms folder in IAS?
2 Are you able to access the icon if u directly enter the icon value ?
http://www.Alexyscorp.com/myicon.gif
if its not port 80 enter the port
3 In the httpd.conf file whats the root directory ? Try putting the icon there
Best Regards
Rajesh Alex
Message was edited by: Rajesh Alex
Alex(AlexysCorp)

Best Practices for deployment of Oracle 10g database.

Hello ,
Is anyone aware of a whitepaper/ document that talks about best pratices in deploying a database on Oracle 10g and configuration of the database to utilize all the features available in 10g ( eg. ADDM , reports setup etc )
Thanking you in Advance.
Cheers..rCube

Appreciate the input Jaffer. Thanks.
However I was referring to a Best Practices whitepaper like the one existing for Data Guard & MAA available at the follwogng url : - http://www.oracle.com/technology/deploy/availability/htdocs/maa.htm
Is there something available along the same lines ?
Cheers..rCube

XWindows client for Redhat EL5/Oracle 10g

I am trying to install Solman 4.0 on to a Redhat EL5/Oracle 10g platform but the sapinst screen does not refresh when we move through the installation. The xwindows client is CYGWIN and is running on a WinXP workstation.
Has anyone else experienced this and what did you do to fix it? May this be because of a problem with the xwindows client? If so can someone recommend a shareware xwindows client to use? We are currently at the most recent version for sapinst so I cannot patch that.
Steve

I know this effect with cygwin/X.
I see several options:
1. Resize the window everytime an update was made, then the window will be repainted. That's annoying, but it works.
2. install sapinst locally on your WinXP and start sapinst in server mode.
3. try another XServer like XDeep/32 or X-Win32
Norbert

How to find unused indexes in oracle 10g r2

Hi all,
db:oracle 10.2.0.3
os:solaris
i want rebuilt the some of the indexes (due poor performence of db)
how to find the unused indexes in oracle 10gr2 database.?
can any one help me out plz.

kk001 wrote:
Hi all,
db:oracle 10.2.0.3
os:solaris
i want rebuilt the some of the indexes (due poor performence of db)
how to find the unused indexes in oracle 10gr2 database.?
can any one help me out plz.You can use V$OBJECT_USAGE.
But how you decide need rebuilding indexes?
How you decide problem related indexes?
What is exactly your mean "due poor performence of db"? some queries hang/long running or whole system hang or has poor performance?
In generally do not need rebuilding index(unless specially cases),first give we above questions`s answers.

Specify File Encoding(Japanese Characters) for UTL_FILE in Oracle 10g

Hi All,
I am creating a text file using the UTL_FILE package. The database is Oracle 10G and the charset of DB is UTF-8.
The file is created on the DB Server machine itself which is a Windows 2003 machine with Japanese OS. Further, some tables contain Japanese characters which I need to write to the file.
When these Japanese characters are written to the text file they occupy 3 bytes instead of 1 and distort the format of the file, I need to stick to.
Can somebody suggest, is there a way to write the Japanese character in 1 byte or change the encoding of the file type to something else viz. ShiftJIS etc.
Thanking in advance,
Regards,
Tushar

Are you using the UTL_FILE.FOPEN_NCHAR function to open the files?
Cheers, APC

Re:The requirements for installing the Oracle 10g

Hi
I wish to install Oracle 10g on a Laptop(Pentium 4 AND 512 Mb Ram).
Is this configuration enough?

The following link should provide useful information.
http://download-east.oracle.com/docs/html/B10130_02/reqs.htm#i1005703

Error synchronizing text index in oracle 10g

Hi,
I am getting errors while trying to synchronize the text index on a xmltype table.
SQL> exec ctx_ddl.sync_index('CTX_INDEX');
BEGIN ctx_ddl.sync_index('CTX_INDEX'); END;
ERROR at line 1:
ORA-20000: Oracle Text error:
DRG-50857: oracle error in drsxsopen
ORA-00904: "BASE"."SYS_NC00162$"."GETCLOBVAL": invalid identifier
ORA-06512: at "CTXSYS.DRUE", line 160
ORA-06512: at "CTXSYS.CTX_DDL", line 539
ORA-06512: at line 1
I will appreciate it if someone can help me figure out a solution.
(Oracle database version - 10.2.0.1)
Thanks,
Uma

Testing with 10.2.0.2.0 I do not see the problem. Is there something significanly different between your environement and the one in this testcase
SQL*Plus: Release 10.2.0.2.0 - Production on Tue Feb 28 16:16:54 2006
Copyright (c) 1982, 2005, Oracle. All Rights Reserved.
SQL> spool createTextIndex.log
SQL> --
SQL> connect &1/&2
Connected.
SQL> --
SQL> desc ENTRY_TABLE
Name                                      Null?    Type
TABLE of SYS.XMLTYPE(XMLSchema "http://www.uniprot.org/support/docs/uniprot.xsd" Element "entry") STORAGE Object-relational TYPE "ENTRY_T"
SQL> /
SP2-0103: Nothing in SQL buffer to run.
SQL> create index UNIPROT_FULL_TEXT
2      on ENTRY_TABLE e (object_value)
3         indextype is ctxsys.context
4         parameters ( 'section group ctxsys.NULL_SECTION_GROUP' )
5 /
Index created.
SQL> quit
Disconnected from Oracle Database 10g Enterprise Edition Release 10.2.0.2.0 - Production
With the Partitioning, OLAP and Data Mining options
SQL*Plus: Release 10.2.0.2.0 - Production on Tue Feb 28 16:16:58 2006
Copyright (c) 1982, 2005, Oracle. All Rights Reserved.
SQL> spool loadFile_&3..log
SQL> set trimspool on
SQL> connect &1/&2
Connected.
SQL> --
SQL> set timing on
SQL> --
SQL> declare
2    result boolean;
3 begin
4    result := dbms_xdb.createResource('/home/&1/&3',
5                                      bfilename(USER,'&3'),nls_charset_id('AL32UTF8'));
6 end;
7 /
old   4:   result := dbms_xdb.createResource('/home/&1/&3',
new   4:   result := dbms_xdb.createResource('/home/BASE/testcase.xml',
old   5:                                     bfilename(USER,'&3'),nls_charset_id('AL32UTF8'));
new   5:                                     bfilename(USER,'testcase.xml'),nls_charset_id('AL32UTF8'));
PL/SQL procedure successfully completed.
Elapsed: 00:00:00.70
SQL> commit
2 /
Commit complete.
Elapsed: 00:00:00.08
SQL> quit
Disconnected from Oracle Database 10g Enterprise Edition Release 10.2.0.2.0 - Production
With the Partitioning, OLAP and Data Mining options
SQL*Plus: Release 10.2.0.2.0 - Production on Tue Feb 28 16:16:59 2006
Copyright (c) 1982, 2005, Oracle. All Rights Reserved.
SQL> spool testcase.log
SQL> --
SQL> connect &1/&2
Connected.
SQL> --
SQL> --
SQL> -- Testcase code here
SQL> --
SQL> set trimspool on
SQL> set autotrace on explain
SQL> set timing on
SQL> set pages 0 lines 140 long 100000
SQL> --
SQL> select count(*)
2    from ENTRY_TABLE
3 /
         1
Elapsed: 00:00:00.21
Execution Plan
Plan hash value: 4248071425
| Id | Operation          | Name        | Rows | Bytes | Cost (%CPU)| Time    |
|   0 | SELECT STATEMENT   |             |     1 |    20 |     3   (0)| 00:00:01 |
|   1 | SORT AGGREGATE    |             |     1 |    20 |            |         |
|* 2 |   TABLE ACCESS FULL| ENTRY_TABLE |     1 |    20 |     3   (0)| 00:00:01 |
Predicate Information (identified by operation id):
   2 - filter(SYS_CHECKACL("ACLOID","OWNERID",xmltype('<privilege
              xmlns="http://xmlns.oracle.com/xdb/acl.xsd"
              xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance"
              xsi:schemaLocation="http://xmlns.oracle.com/xdb/acl.xsd
              http://xmlns.oracle.com/xdb/acl.xsd DAV:http://xmlns.oracle.com/xdb/dav.xs
              d"><read-properties/><read-contents/></privilege>'))=1)
Note
   - dynamic sampling used for this statement
SQL> select object_value
2    from ENTRY_TABLE
3   where existsNode (OBJECT_value, '/entry[accession/text()="P19084"]','xmlns="http://uniprot.org/uniprot"')>0
4 /
*** Object defn.s out of sync w/ data
***<entry xmlns="http://uniprot.org/uniprot" dataset="Swiss-Prot" created="1990-11-01" modified="2006-02-07" version="45">
<accession>P19084</accession>
<name>11S3_HELAN</name>
PLTLWANRYQLSREEAQQLKFSQRETVLFAPSFSRGQGIRASR
</sequence>
</entry>
Elapsed: 00:00:03.13
Execution Plan
Plan hash value: 4171466134
| Id | Operation                    | Name           | Rows | Bytes | Cost (%CPU)| Time     |
|   0 | SELECT STATEMENT             |                |     1 | 10115 |   804 (1)| 00:00:10 |
|   1 | NESTED LOOPS                |                |     1 | 10115 |   804 (1)| 00:00:10 |
|   2 |   SORT UNIQUE                |                |     1 | 2016 |   802 (0)| 00:00:10 |
|* 3 |    INDEX FAST FULL SCAN      | ACCESSION_DATA |     1 | 2016 |   802 (0)| 00:00:10 |
|* 4 |   TABLE ACCESS BY INDEX ROWID| ENTRY_TABLE    |     1 | 8099 |     1 (0)| 00:00:01 |
|* 5 |    INDEX UNIQUE SCAN         | ACCESSION_LIST |     1 |       |     0 (0)| 00:00:01 |
Predicate Information (identified by operation id):
   3 - filter("ACCESSION_TABLE"."SYS_XDBBODY$"='P19084')
   4 - filter(SYS_CHECKACL("ACLOID","OWNERID",xmltype('<privilege
              xmlns="http://xmlns.oracle.com/xdb/acl.xsd"
              xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance"
              xsi:schemaLocation="http://xmlns.oracle.com/xdb/acl.xsd
              http://xmlns.oracle.com/xdb/acl.xsd DAV:http://xmlns.oracle.com/xdb/dav.xsd"><read-prop
              erties/><read-contents/></privilege>'))=1)
   5 - access("NESTED_TABLE_ID"="ENTRY_TABLE"."SYS_NC0001100012$")
Note
   - dynamic sampling used for this statement
SQL> quit
Disconnected from Oracle Database 10g Enterprise Edition Release 10.2.0.2.0 - Production
With the Partitioning, OLAP and Data Mining options
SQL*Plus: Release 10.2.0.2.0 - Production on Tue Feb 28 16:17:03 2006
Copyright (c) 1982, 2005, Oracle. All Rights Reserved.
SQL> spool syncTextIndex.log
SQL> --
SQL> connect &1/&2
Connected.
SQL> --
SQL> exec ctx_ddl.sync_index('UNIPROT_FULL_TEXT')
PL/SQL procedure successfully completed.
SQL> /
SP2-0103: Nothing in SQL buffer to run.
SQL> quit
Disconnected from Oracle Database 10g Enterprise Edition Release 10.2.0.2.0 - Production
With the Partitioning, OLAP and Data Mining options
bash-2.05b$Message was edited by:
mdrake

Change Data type column - Performance of Index in Oracle 10g

Hi,
I have a table with too many rows (over 2000000 rows) . I have changed datatype (NUMBER to VARCHAR2) of an indexed column (the index is only for this column), using a temporay backup table:
CREATE TABLE BKTABLE AS SELECT FIELD, ROWID AS IDROW FROM ORIGNALTABLE;
UPDATE ORIGNALTABLE SET FIELD = NULL;
ALTER ORIGNALTABLE MODIFY FIELD VARCHAR2(256);
UPDATE ORIGNALTABLE A SET FIELD = (SELECT FIELD FROM BKTABLE B WHERE B.IDROW = A.IDROW);
This way worked OK.
There is any performance knowed issue over an index of ORIGNALTABLE? Need rebuild this index?
Thks!

Need rebuild this index? YES
ALWAYS
Post Operating System (OS) name & version for DB server system.
Post results of
SELECT * from v$version
or post Oracle version to 4 decimal places

How to alter value for processes in Oracle 10g XE

Im installing weblogic server 11g. Im getting the error
RCU-6083:Failed - Check prerequisites requirement for selected component:SOAINFRA
Please refer to RCU log at C:\stageSOA\rcuHome\rcu\log\logdir.2010-06-18_17-04\rcu.log for details.
RCU-6107:DB Init Param Prerequisite failure for: processes
Current Value is 40. It should be greater than or equal to 200.
RCU-6092:Component Selection validation failed. Please refer to log at C:\stageSOA\rcuHome\rcu\log\logdir.2010-06-18_17-04\rcu.log for details.
I have read in a forum this this command will work
alter system set Processes=300 scope=spfile;
where should I write this command. I have tried the SQL command line. But it says its invalid

One thing I detected here as a bad practice, you blindly issued the command "ALTER SYSTEM ... SCOPE=SPFILE" and later on you asked why you were not able to see the change.
It lets me know that you applied a change without even bothering to find out what it was about. Please make sure next time you blindly apply a command this doesn't start with "DROP ...." or you may face a hard time.
~ Madrid
http://hrivera99.blogspot.com

PCTFREE setting for index in Oracle 10g R2

Similar Messages

Maybe you are looking for