Post script Language Level 2 or 3 ?

Hello
Iam using StreamPrintService to generate postscript file. Please let me know the language level of post script file generated by jdk1.4. (whether it is level 2 or 3 )
Thanks in advance
Vinayak

PostScript: Level 2

Similar Messages

How text data is formated in post script language level 2

Hi all,
In post script language level 3 files text data is converted to hexadesimal format and kept in between xshow commands. But in postscript language level 2 files, text data is converted to some other format.
Can you please inform me, to which format text data is converted.
Thanks,
Sateesh.

PostScript: Level 2

High-level/scripting languages learning thread

Hi all,
In recent weeks i have looked into many of the high-level/scripting languages. All of them easy enough to get into quickly. My problem though is not learning them actually, but that i don't actually have much use now. Sure, from time to time i need a little script for something (and sometimes i then translate that script to lots of languages just for the heck of it like here), but that doesn't amount to much. However on the other hand i'm neither in some job regarding IT/programming nor do i study anything with respect to programming, and i also am not interested in more programming as in compiled languages, system programming or things like that. (At the very least not yet). So i'm doing this just for fun and learning (two of my lifegoals). I am aware of for example Project Euler, however i'm not mathematically interested enough for that.
So, the purpose of this thread are two things.
a) I'm asking for suggestions for interesting things i could do with high-level/scripting languages, maybe someone knows of something Project Euler like but for more mundane things and not maths.
b) So as to give this thread another purpose and not make it only about me, maybe people who have some problem writing a script for something can ask for help. I know of the other thread (the long one, "commandline utilites/scripts"), but that one seems to be more of the sort where someone posts a script he/she uses and then maybe someone posts an answer to that. So for this thread here people should be able to ask for help while creating the script, or even "Where to start". This could serve both the people with the problem and the people wanting to learn more about some language but not finding a way to apply the learning.
Ogion

a) I'm asking for suggestions for interesting things i could do with high-level/scripting languages, maybe someone knows of something Project Euler like but for more mundane things and not maths.
To me, this sounds like the Python Challenge: http://www.pythonchallenge.com/
Also, if you're not interested in math, maybe you might still find yourself engaged by something like natural language processing, games, or simulations? I personally find the "Natural Language Toolkit" for Python to be a lot of fun.

How do I download a post script driver to create a PDF, I am receiving an erro message system error:1797 ?

I am trying to create a PDF from my layout page. I get the message that I have to download a post script driver. I have gone to the Adobe download site and attempted to download the driver but I get the error message Failure is AddPrinter (generic post script printer). System error: 1797 Printer driver unknown.
I have a HP Office Jet 6600 printer. Can anyone help?

Hi Chapinpro,
In order to convert your document/ Print your document to PDF you need to have PDF printer installed, which gets installed after installing Adobe Acrobat.
Using Adobe Acrobat you can convert most of documents to PDF.
Note: Postscript drivers are meant to convert documents to PDF format.
"These drivers enable you to print documents from applications running in these Windows platforms to any printer that includes Adobe PostScript Level 2 or Adobe PostScript 3. You can also use this driver if you received a previous version of AdobePS bundled with an Adobe application, and are printing to any device that supports PostScript language level 2 or later. This version of the AdobePS printer driver does not work with PostScript Level 1 devices, and does not work with Windows NT 3.5x. " Reference:: Adobe - PostScript printer drivers : For Windows : Adobe Universal PostScript Windows Driver Installer 1.0.6 - English
Regards,
Ajlan Huda.

Post Script 2UP trayswitch Command need

Hi friends,
I am a fresher in post script file printing. I need a command for postscript 2UP trayswitching for xerox printers. Please help me.

PostScript is a programming language, and a PostScript file is a program. So editing is entirely possible, if you are prepared to spend the time to learn the programming language in detail.
I can tell you that this fragment means nothing by itself. The names w, x, L are not part of the PostScript language. They will be procedures defined above. A program can take a lot of unravelling and understanding, even for a very experienced PostScript programmer.

New java-like scripting language w/ powerful regex

Hi,
Just wanted to let you know that there's now a new scripting language called P~ with the following important aspects:
1) matches and exceeds Perl regex solveability -- e.g. offers full regex-based boolean query on non-indexed corpus, offers completely general side-effects, more accurate than Perl code assertions
2) basic grammar is very Java like
3) regex grammar is algebraic, not metacharacter-based, leads to more readable and maintainable solutions to hard problems
4) offers an easy tool to debug matching behavior of your regexes (rules)
5) though a full featured scripting language, you can write scriptlets and call them from Java classes, with arguments. Allows you to use your regex solutions in Java applications.
6) the language is offered as a Java library, as well as a standalone application that runs the library. This means that your scripts can import java classes available in the classpath, you can leverage existing Java libraries.
Check out the website and try it out: http://ptilde.pbwiki.com
Andy

True to an extent. We don't yet have lookaround assertions and won't have backreferencing any time soon. But there are same-time assertions which offer much of the same, and allow for boolean query.
More accurate general statement insertion side-effects (than Perl code assertions) means that your statements are executed if and only they wrap a subpattern that is part of the ultimate best match -- Perl code assertions execute when the automata encounters them, even if where they are in the regex is ultimately not part of the match, or even if there is no match at all. This aspect is a huge part of the solveability advantage.
As to the regex test cases, there are about 1000, and we will post them soon.

Using context variable in formcalc scripting language.

Hi all,
I wanted to know if it is possible to use context variables in formcalc. I wanted to use those variables in "if else" condition in formcalc scripting language. Please post the sample code also as i am new to adobe forms.
Regards,
Vinod

Hi ,
Each variable define in the context can be used on the layout of the form and/or in script linked to fields.
This can be done in formcalc or in javascript language , without any problem . You have only to acess the correct variable in the script.
For getting variable in a script you must define the complete name of the variable, example "Myform.Header.Data.Myvariable" get access to variable MyVariable define in the context under nodes Header/Data .
Hope it's help you
regards.

Scripting Languages Tool Preview

Ok, this new thread is for posting about the Scripting Languages Tool Preview. Any comments, thoughts, ideas, contributions?
Greetings,
Blag.

John: as Frank said, we'd love to see generators for other languages - like JavaScript - in future. But we don't want to create them all alone. So here's the deal: we create the framework and some generators for the most widely-used languages and you cool guys on SDN build on that and create other generators, other viewers, anything you think is useful. And for all questions or problems we (SAP Scripting Team) will offer all the help we can. I'm very looking forward to see what will evolve from this
This works two-way. It's you who have year-long experience in all kind of scripting languages - combined it's much more knowledge than we can have. So when I face a scripting problem during generator-creation I'll just ask for your help here
Piers: no, it did not arrive. Please send again. I checked my profile and the mail-address was just not set to 'visible'. Your's isn't, too
About the 'integration': it is a clear goal to let it work inside other frameworks (Eclipse-based). As we do not have or use all of these I can just assume that it'll work just fine using the standard Eclipse mechanisms. Scripting in a Box is definitely a good candidate for this, and I myself use it for testing both tool integration and generated scripts.
Bundling - we thought about this, but there might be legal issues, so we have to wait for an official approval. Meanwhile it's not that complicated just getting SiaB and installing the tool afterwards
:Frederic:

Perl versus other "scripting" languages when doing string operations

I've been told that perl is a "scripting" language like the other languages mentioned in this forum.
If that's true, can these other languages handle the following spec as well as perl can? (See spec at end of this post.)
Or is perl stronger in string operations than the other scripting languages mentioned here?
Here's the spec:
1. I give your program a twenty-letter alphabet (any twenty letter alphabet)
For example:
ABCDEFGHIJKLMNOPQRST
2. I also give your program four groups (any four groups) of letters in this alphabet:
For example:
s: A,B,C,D,E
p: F,G,H,I,J
d: K,L,M,N,O
e: P,Q,R,S,T
3. I also give your program a sequence over the twenty-letter alphabet that I gave you in Step (1) above:
For example:
ABCDEFGHIJKLMNOPQRSTSRQPONMLKJIHGFEDCBA
4. Given this sequence,you search for pairs of adjacent letters (x,y) where X and y are from different groups (the groups defined in Step (2) above.)
Also, you return the results of this search by giving me back the following two strings:
ABCD(EF)GHI(JK)LMN(OP)QRSTSRQ(PO)NML(KJ)IHG(FE)DCBA
ABCD(sp)GHI(pd)LMN(de)QRSTSRQ(ed)NML(dp)IHG(ps)DCBA
5. Note: if I give you a sequence that contains "overlapping" ordered pairs like:
...EFK...
then you ignore the second ordered pair. That is, you return:
...(EF)K

OK - here is the final stuff on the "C" side.
To execute the program, the command line is:
20let.exe file1.txt file2.txt file3.txt > fileout.txt
Below, I've provided:
a) source code 20let.c
b) sample input file1.txt
c) sample input file2.txt
d) sample input file3.txt
e) output fileout.txt generated from these input files.
As soon as Bill finishes the perl version of the source code, I'll post that also.
source code of 20let.c
// 20let.c5
#include <stdio.h>
#include <stdlib.h>
int T[333],A[99999],G[333],B[99999],C[99999],N[299999],P[99999];
int n1,n2,f,p,x1,x2,n,m,a,b,c,i,j,k,x,y,z;
int E[233][233];
FILE *file;
int substrings(int x1,int x2);
int main(int argc, char*argv[]) {
 if(argc<3){
 printf("\nusage:20let protein-file nucleotide-file pairs-include-file\n\n");
 printf("marks amino-acid-pairs from different groups in protein-file\n");
 printf("iff they are in the include-file\n");
 exit(1);
//----------------define the groups G['I'] = 's', e.g.
 x='s'; G['I']=x;G['M']=x;G['V']=x;G['A']=x;G['G']=x;
 x='p'; G['F']=x;G['L']=x;G['P']=x;G['W']=x;G['W']=x;
 x='d'; G['H']=x;G['Q']=x;G['D']=x;G['E']=x;G['E']=x;
 x='t'; G['S']=x;G['T']=x;G['Y']=x;G['N']=x;G['C']=x;G['K']=x;G['R']=x;
//----------------the 4 bases T['a'] = 0 thru 3
 for(x=0;x<222;x++)
 T[x]=-999;
 T['a']=0;T['c']=1;T['g']=2;T['t']=3;
 T['A']=0;T['C']=1;T['G']=2;T['T']=3;
for(i=65;i<70;i++)G='s';
for(i=70;i<75;i++)G='p';
for(i=75;i<80;i++)G='d';
for(i=80;i<85;i++)G='t';
//---------------- read include-file file3 xxxyyy pairs E[x][y] of interest
 f=0;
 for(x=0;x<222;x++)
 for(y=0;y<222;y++)
 E[x][y]=0;
 if((file=fopen(argv[3],"rb"))==NULL){
 printf("\ncan't open exclude-file %s\n",argv[1]);exit(1);
mq1: if(feof(file))
 goto mq3;
 x=fgetc(file);y=fgetc(file);x=fgetc(file);
 x=T[fgetc(file)]*16+T[fgetc(file)]*4+T[fgetc(file)];
 y=T[fgetc(file)]*16+T[fgetc(file)]*4+T[fgetc(file)];
 if(x<64 && x>=0 && y<64 && y>=0){
 E[x][y]=1;
 f++;
mq2: if(feof(file))
 goto mq3;
 a=fgetc(file);
 if(a!=10)
 goto mq2;
 goto mq1;
mq3: fclose(file);
//------------------read amino-acid file file1 == P array
 if((file=fopen(argv[1],"rb"))==NULL){
 printf("\ncan't open file %s\n",argv[1]);exit(1);}
 p=0;
m1p: if(feof(file))
 goto m2p;
 p++;
 P[p]=fgetc(file);
 if(G[P[p]]==0)
 p--;
 goto m1p;
m2p:;
 fclose(file);
//------------------read nucleotide file file2 == N array
 if((file=fopen(argv[2],"rb"))==NULL){
 printf("\ncan't open file %s\n",argv[1]);exit(1);
 n=0;
m1n: if(feof(file))
 goto m2n;
 n++;
 N[n]=fgetc(file);
 if(N[n]!='a' && N[n]!='c' && N[n]!='g' && N[n]!='t')
 n--;
 goto m1n;
m2n:;
 fclose(file);
//for(i=1;i<=p;i++)printf("%c",P);printf("\n");
//for(i=1;i<=n;i++)printf("%c",N);printf("\n");
//printf("%i include-pairs %i nucleotides %i proteins\n",f,n,p);
//------------1st line------------------ B = result
 m=0;
 for(i=1;i<=p;i++){
 n1=T[N[i*3-2]]*16+T[N[i*3-1]]*4+T[N[i*3]];
 n2=T[N[i*3+1]]*16+T[N[i*3+2]]*4+T[N[i*3+3]];
//printf("\ni=%i p=%i n1=%i n2=%i\n",i,p,n1,n2);
 if(E[n1][n2]<1 || G[P]==G[P[i+1]] /* || i==n */){
 printf("%c",P);
 m++;
 B[m]=P;
 goto m3;
 printf("(%c%c)",P,P[i+1]);
 i++;
 m++;
 B[m]='(';
 m++;
 B[m]=P[i-1];
 m++;
 B[m]=P;
 m++;
 B[m]=')';
//printf("(%c)%c",G[A],G[A[i+1]]);i++;
 m3:;
 printf("\n");
//------------2nd line------------------ C = result
 m=0;
 for(i=1;i<=p;i++){
 n1=T[N[i*3-2]]*16+T[N[i*3-1]]*4+T[N[i*3]];
 n2=T[N[i*3+1]]*16+T[N[i*3+2]]*4+T[N[i*3+3]];
 if(E[n1][n2]<1 || G[P]==G[P[i+1]] /* || i==n */){
 printf("%c",P);
 m++;
 C[m]=P;
 goto m4;
 printf("(%c%c)",G[P],G[P[i+1]]);
 i++;
 m++;
 C[m]='(';
 m++;
 C[m]=G[P[i-1]];
 m++;
 C[m]=G[P];
 m++;
 C[m]=')';
//printf("(%c)%c",G[A],G[A[i+1]]);i++;
 m4:;
 printf("\n");
//for(i=1;i<=m;i++)printf("%c",B);printf("\n");
//------------3rd line------------------ printf only
 m=0;
 for(i=1;i<=p;i++){
 n1=T[N[i*3-2]]*16+T[N[i*3-1]]*4+T[N[i*3]];
 n2=T[N[i*3+1]]*16+T[N[i*3+2]]*4+T[N[i*3+3]];
 if(E[n1][n2]<1 || G[P]==G[P[i+1]] /* || i==n */){
 printf("%c%c%c",N[i*3-2],N[i*3-1],N[i*3]);
 goto m33;
 printf("(%c%c%c%c%c%c)",N[i*3-2],N[i*3-1],N[i*3],N[i*3+1],N[i*3+2],N[i*3+3]);
 i++;
 m33:;
 printf("\n");
//--------------substrings------------
 substrings(20,29);
 substrings(30,39);
 substrings(40,49);
 substrings(50,59);
 substrings(60,69);
 return 0;
int substrings(int x1,int x2)
 printf("\n");
 printf("lengths %i - %i : \n",x1,x2);
 for(i=1; i<p; i++)
 for (j=i+x1; j<i+x2; j++) {
 if (C>95 && C[j]>95) { // if lc letter in line2
 for(x=i;x<=j;x++)
 printf("%c",C[x]);
 printf("|");
 for(x=i;x<=j;x++)
 if(B[x]>44) // if not () in line 1
 printf("%c",B[x]);
 printf("|");
 for(x=i;x<=j;x++)
 if(C[x]>95) // if lc letter line2
 printf("%c",C[x]);
 printf("\n");}
input file1.txt
MKKHTDQPIADVQGSPDTRH
IAIDRVGIKAIRHPVLVADK
DGGSQHTVAQFNMYVNLPHN
FKGTHMSRFVEILNSHEREI
SVESFEEILRSMVSRLESDS
GHIEMTFPYFVNKSAPISGV
KSLLDYEVTFIGEIKHGDQY
GFTMKVIVPVTSLCPCSKKI
SDYGAHNQRSHVTISVHTNS
FVWIEDVIRIAEEQASCELF
GLLKRPDEKYVTEKAYNNPK
FVEDIVRDVAEILNHDDRID
AYVVESEBFESIHNHSAYAL
IERD
input file2.txt
atgaaaaaacatactgatcaacctatcgctgatgtgcagggctcaccggataccagacat
atcgcaattgacagagtcggaatcaaagcgattcgtcacccggttctggtcgccgataag
gatggtggttcccagcataccgtggcgcaatttaatatgtacgtcaatctgccacataat
ttcaaagggacgcatatgtcccgttttgtggagatactaaatagccacgaacgtgaaatt
tcggttgaatcatttgaagaaattttgcgctccatggtcagcaggctggaatcagattcc
ggccatattgaaatgacttttccctacttcgtcaataaatcagcccctatctcaggtgta
aaaagcttgctggattatgaggtaacctttatcggcgaaattaaacatggcgatcaatat
gggtttaccatgaaggtgatcgttcctgttaccagcctgtgcccctgctccaagaaaata
tccgattacggtgcgcataaccagcgttcacacgtcaccatttctgtacacactaacagc
ttcgtctggattgaggacgttatcagaattgcggaagaacaggcctcatgcgaactgttc
ggtctgctgaaacggccggatgaaaaatatgtcacagaaaaggcctataacaatccgaaa
tttgtcgaagatatcgtccgtgatgtcgccgaaatacttaatcatgatgaccggatagat
gcctatgttgttgaatcagaaaactttgaatccatacataatcactctgcatacgcactg
atagagcgcgac
input file3.txt
FA tttgcc
FA ttcgcc
FA tttgct
FA ttcgct
LK ttaaaa
LK ttgaaa
LK ttaaag
LK ttgaag
LS ctgctc
LS ctgctt
LS ctactc
LS ctactt
LT ctcacc
LT ctcact
LT cttacc
LT cttact
LY ctctac
LY ctctat
LY ctttac
LY ctttat
LG ctcggc
LG ctcggt
LG cttggc
LG cttggt
IP attccc
IP attcct
IP atcccc
IP atccct
IP attcca
IP attccg
IP atccca
IP atcccg
ML atgctc
ML atgctt
ML atgctc
ML atgctt
VL gtgctg
VL gtgcta
VL gtactg
VL gtacta
VS gtgtcc
VS gtatct
VS gtgtcc
VS gtatct
VT gtcacc
VT gtcact
VT gttacc
VT gttact
VS gtcagc
VS gtcagt
VS gttagc
VS gttagt
SL tcgctg
SL tcgcta
SL tcactg
SL tcacta
SP tctcca
SP tctccg
SP tcccca
SP tccccg
PV ccggtg
PV ccggta
PV ccagtg
PV ccagta
PG cccggc
PG cccggt
PG cctggc
PG cctggt
TL acgctg
TL acgcta
TL acactg
TL acacta
TP acgccg
TP acgcca
TP acaccg
TP acacca
AL gcttta
AL gctttg
AL gcctta
AL gccttg
AP gcgccg
AP gcgcca
AP gcaccg
AP gcacca
AP gctcca
AP gctccg
AP gcccca
AP gccccg
AN gctaat
AN gctaac
AN gccaat
AN gccaac
AS gccagc
AS gccagt
AS gctagc
AS gctagt
YP tatccg
YP tatcca
YP tacccg
YP taccca
HP catccg
HP catcca
HP cacccg
HP caccca
QR cagcga
QR cagcgg
QR caacga
QR caacgg
DL gatttg
DL gattta
DL gacttg
DL gactta
EN gaaaat
EN gaaaac
EN gagaat
EN gagaac
EK gaaaaa
EK gaaaag
EK gagaaa
EK gagaag
ER gagcga
ER gagcgg
ER gaacga
ER gaacgg
WR tggcga
WR tggcgg
RV cgggtg
RV cgggta
RV cgagtg
RV cgagta
RW cggtgg
RW cgatgg
SG agtgga
SG agtggg
SG agcgga
SG agcggg
GF ggtttt
GF ggtttc
GF ggcttt
GF ggcttc
GL gggctg
GL gggcta
GL ggactg
GL ggacta
GY gggtat
GY gggtac
GY ggatat
GY ggatac
GY ggttat
GY ggttac
GY ggctat
GY ggctac
GK ggaaaa
GK ggaaag
GK gggaaa
GK gggaag
GK ggcaag
GK ggcaaa
GK ggtaag
GK ggtaaa
GW ggctgg
GW ggttgg
GR gggcgg
GR gggcga
GR ggacgg
GR ggacga
GS ggcagc
GS ggcagt
GS ggtagc
GS ggtagt
output fileout.txt
MKKHTDQPIADVQGSPDTRHIAIDRVGIKAIR(HP)VLVADKDGGSQHTVAQFNMYVNLPHNFKGTHMSRFVEILNSHEREISVESFEEILRSM(VS)RLESDSGHIEMTFPYFVNKSAPISGVKSLLDYEVTFIGEIKHGDQYGFTMKVIVP(VT)SLCPCSKKISDYGAHNQRSH(VT)ISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPD(EK)YVT(EK)AYNNPKFVEDIVRDVAEILNHDDRIDAYVVES(EF)ESIHNHSAYALIERD
MKKHTDQPIADVQGSPDTRHIAIDRVGIKAIR(dp)VLVADKDGGSQHTVAQFNMYVNLPHNFKGTHMSRFVEILNSHEREISVESFEEILRSM(st)RLESDSGHIEMTFPYFVNKSAPISGVKSLLDYEVTFIGEIKHGDQYGFTMKVIVP(st)SLCPCSKKISDYGAHNQRSH(st)ISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPD(dt)YVT(dt)AYNNPKFVEDIVRDVAEILNHDDRIDAYVVES(dp)ESIHNHSAYALIERD
atgaaaaaacatactgatcaacctatcgctgatgtgcagggctcaccggataccagacatatcgcaattgacagagtcggaatcaaagcgattcgt(cacccg)gttctggtcgccgataaggatggtggttcccagcataccgtggcgcaatttaatatgtacgtcaatctgccacataatttcaaagggacgcatatgtcccgttttgtggagatactaaatagccacgaacgtgaaatttcggttgaatcatttgaagaaattttgcgctccatg(gtcagc)aggctggaatcagattccggccatattgaaatgacttttccctacttcgtcaataaatcagcccctatctcaggtgtaaaaagcttgctggattatgaggtaacctttatcggcgaaattaaacatggcgatcaatatgggtttaccatgaaggtgatcgttcct(gttacc)agcctgtgcccctgctccaagaaaatatccgattacggtgcgcataaccagcgttcacac(gtcacc)atttctgtacacactaacagcttcgtctggattgaggacgttatcagaattgcggaagaacaggcctcatgcgaactgttcggtctgctgaaacggccggat(gaaaaa)tatgtcaca(gaaaag)gcctataacaatccgaaatttgtcgaagatatcgtccgtgatgtcgccgaaatacttaatcatgatgaccggatagatgcctatgttgttgaatca(gaaaac)tttgaatccatacataatcactctgcatacgcactgatagagcgc
lengths 20 - 29 :
st)SLCPCSKKISDYGAHNQRSH(s|VTSLCPCSKKISDYGAHNQRSHV|sts
st)SLCPCSKKISDYGAHNQRSH(st|VTSLCPCSKKISDYGAHNQRSHVT|stst
t)SLCPCSKKISDYGAHNQRSH(s|TSLCPCSKKISDYGAHNQRSHV|ts
t)SLCPCSKKISDYGAHNQRSH(st|TSLCPCSKKISDYGAHNQRSHVT|tst
lengths 30 - 39 :
st)ISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPD(d|VTISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPDE|std
t)ISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPD(d|TISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPDE|td
t)ISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPD(dt|TISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPDEK|tdt
dt)AYNNPKFVEDIVRDVAEILNHDDRIDAYVVES(d|EKAYNNPKFVEDIVRDVAEILNHDDRIDAYVVESE|dtd
dt)AYNNPKFVEDIVRDVAEILNHDDRIDAYVVES(dp|EKAYNNPKFVEDIVRDVAEILNHDDRIDAYVVESEF|dtdp
t)AYNNPKFVEDIVRDVAEILNHDDRIDAYVVES(d|KAYNNPKFVEDIVRDVAEILNHDDRIDAYVVESE|td
t)AYNNPKFVEDIVRDVAEILNHDDRIDAYVVES(dp|KAYNNPKFVEDIVRDVAEILNHDDRIDAYVVESEF|tdp
lengths 40 - 49 :
st)ISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPD(dt)YVT(d|VTISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPDEKYVTE|stdtd
st)ISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPD(dt)YVT(dt|VTISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPDEKYVTEK|stdtdt
t)ISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPD(dt)YVT(d|TISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPDEKYVTE|tdtd
t)ISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPD(dt)YVT(dt|TISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPDEKYVTEK|tdtdt
dt)YVT(dt)AYNNPKFVEDIVRDVAEILNHDDRIDAYVVES(d|EKYVTEKAYNNPKFVEDIVRDVAEILNHDDRIDAYVVESE|dtdtd
dt)YVT(dt)AYNNPKFVEDIVRDVAEILNHDDRIDAYVVES(dp|EKYVTEKAYNNPKFVEDIVRDVAEILNHDDRIDAYVVESEF|dtdtdp
t)YVT(dt)AYNNPKFVEDIVRDVAEILNHDDRIDAYVVES(d|KYVTEKAYNNPKFVEDIVRDVAEILNHDDRIDAYVVESE|tdtd
t)YVT(dt)AYNNPKFVEDIVRDVAEILNHDDRIDAYVVES(dp|KYVTEKAYNNPKFVEDIVRDVAEILNHDDRIDAYVVESEF|tdtdp
lengths 50 - 59 :
t)RLESDSGHIEMTFPYFVNKSAPISGVKSLLDYEVTFIGEIKHGDQYGFTMKVIVP(s|SRLESDSGHIEMTFPYFVNKSAPISGVKSLLDYEVTFIGEIKHGDQYGFTMKVIVPV|ts
lengths 60 - 69 :
dp)VLVADKDGGSQHTVAQFNMYVNLPHNFKGTHMSRFVEILNSHEREISVESFEEILRSM(s|HPVLVADKDGGSQHTVAQFNMYVNLPHNFKGTHMSRFVEILNSHEREISVESFEEILRSMV|dps
dp)VLVADKDGGSQHTVAQFNMYVNLPHNFKGTHMSRFVEILNSHEREISVESFEEILRSM(st|HPVLVADKDGGSQHTVAQFNMYVNLPHNFKGTHMSRFVEILNSHEREISVESFEEILRSMVS|dpst
p)VLVADKDGGSQHTVAQFNMYVNLPHNFKGTHMSRFVEILNSHEREISVESFEEILRSM(s|PVLVADKDGGSQHTVAQFNMYVNLPHNFKGTHMSRFVEILNSHEREISVESFEEILRSMV|ps
p)VLVADKDGGSQHTVAQFNMYVNLPHNFKGTHMSRFVEILNSHEREISVESFEEILRSM(st|PVLVADKDGGSQHTVAQFNMYVNLPHNFKGTHMSRFVEILNSHEREISVESFEEILRSMVS|pst
st)RLESDSGHIEMTFPYFVNKSAPISGVKSLLDYEVTFIGEIKHGDQYGFTMKVIVP(st|VSRLESDSGHIEMTFPYFVNKSAPISGVKSLLDYEVTFIGEIKHGDQYGFTMKVIVPVT|stst
st)SLCPCSKKISDYGAHNQRSH(st)ISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPD(d|VTSLCPCSKKISDYGAHNQRSHVTISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPDE|ststd
st)SLCPCSKKISDYGAHNQRSH(st)ISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPD(dt|VTSLCPCSKKISDYGAHNQRSHVTISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPDEK|ststdt
t)SLCPCSKKISDYGAHNQRSH(st)ISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPD(d|TSLCPCSKKISDYGAHNQRSHVTISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPDE|tstd
t)SLCPCSKKISDYGAHNQRSH(st)ISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPD(dt|TSLCPCSKKISDYGAHNQRSHVTISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPDEK|tstdt
t)SLCPCSKKISDYGAHNQRSH(st)ISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPD(dt)YVT(d|TSLCPCSKKISDYGAHNQRSHVTISVHTNSFVWIEDVIRIAEEQASCELFGLLKRPDEKYVTE|tstdtd
Edited by: David Halitsky on Mar 18, 2008 4:21 AM
Edited by: David Halitsky on Mar 18, 2008 4:22 AM

Scripting Languages are for Insane People!!!!

Hope you brought your flamethrowers because I am feeling a bit chilled.
Sooo I am knee deep in some heavy javascript(Nodejs) and while fighting to populate an array with the results of a sqlite query
(somehow my array is getting nuked nodejs or nodejs-sqlite3 bug? )
I am left scratching my head saying to my self WTF!! This would have taken me like 5 sec in Qt C++. So I wrote up the same example
in Ruby, Python, Java, Lua and Perl. And in every case my Qt C++ example was not only cleaner, shorter but easier to write/understand.
Granted scripting languages are not only valuable but necessary in CERTAIN cases, but the way people use them today is just INSANE.
My primary scripting language is javascript but that is only because my work requires it. But ill take lua over any scripting language any day.
I am going to go sink my teeth in Django see if that pisses me off any less!
Sooo whats your opinion.
Last edited by zester (2011-09-13 05:19:18)

satanselbow wrote:
ethail wrote:
keenerd wrote:But Lua is a scripting language. Maybe I missed the joke?
I think he could be pointing that of the many scripting languajes he has used, seems that only LUA satisfies him, and it's not widely used as he would like. That's what it seemed to me.
Somewhat ironically (within this threads context) - one of Lua's biggest selling points is it's simple integration with other languages, both scripting and higher level.
Good point!
Lua is insanely <-- Word of the day (Pee-Wee Herman Play House AHHHHHHHHHH) easy
to embed and bind.
Little examples I wrote a couple of years ago sooooo it is what it is.
If using C++
extern "C" {
#include "lua.h"
#include "lualib.h"
#include "lauxlib.h"
How to call a C Function from Lua
luaavg.c
#include <stdio.h>
#include "lua.h"
#include "lualib.h"
#include "lauxlib.h"
/* gcc -o luaavg luaavg.c -I/usr/local/include -L/usr/local/lib -llua -lm -ldl */
/* the Lua interpreter */
lua_State* L;
static int average(lua_State *L)
/* get number of arguments */
int n = lua_gettop(L);
double sum = 0;
int i;
/* loop through each argument */
for (i = 1; i <= n; i++)
/* total the arguments */
sum += lua_tonumber(L, i);
/* push the average */
lua_pushnumber(L, sum / n);
/* push the sum */
lua_pushnumber(L, sum);
/* return the number of results */
return 2;
int main ( int argc, char *argv[] )
/* initialize Lua */
L = lua_open();
/* load Lua base libraries */
luaL_openlibs(L);
/* register our function */
lua_register(L, "average", average);
/* run the script */
luaL_dofile(L, "avg.lua");
/* cleanup Lua */
lua_close(L);
/* print */
printf( "Press enter to exit..." );
getchar();
return 0;
-- call a C function
avg, sum = average(10, 20, 30, 40, 50)
print("The average is ", avg)
print("The sum is ", sum)
avg, sum = average(1, 2, 3, 4, 5)
print("The average is ", avg)
print("The sum is ", sum)
--- How to call a Lua Function from C
#include <stdio.h>
#include "lua.h"
#include "lualib.h"
#include "lauxlib.h"
/* gcc -o luadd luadd.c -I/usr/local/include -L/usr/local/lib -llua -lm -ldl */
/* the Lua interpreter */
lua_State* L;
int luaadd ( int x, int y )
int sum;
/* the function name */
lua_getglobal(L, "add");
/* the first argument */
lua_pushnumber(L, x);
/* the second argument */
lua_pushnumber(L, y);
/* call the function with 2 arguments, return 1 result */
lua_call(L, 2, 1);
/* get the result */
sum = (int)lua_tointeger(L, -1);
lua_pop(L, 1);
return sum;
int main ( int argc, char *argv[] )
int sum;
/* initialize Lua */
L = lua_open();
/* load Lua base libraries */
luaL_openlibs(L);
/* load the script */
luaL_dofile(L, "add.lua");
/* call the add function */
sum = luaadd( 10, 15 );
/* print the result */
printf( "The sum is %d\n", sum );
/* cleanup Lua */
lua_close(L);
/* pause */
printf( "Press enter to exit..." );
getchar();
return 0;
-- add two numbers
function add ( x, y )
return x + y
end
--- How to load and call a lua function from c
//last.cc
# extern "C" {
# #include "lua.h"
# #include "lualib.h"
# #include "lauxlib.h"
int main()
double z;
lua_State *L = lua_open();
luaL_openlibs(L);
if (luaL_loadfile(L, "last.lua") || lua_pcall(L, 0, 0, 0)) {
printf("error: %s", lua_tostring(L, -1));
return -1;
lua_getglobal(L, "f");
if(!lua_isfunction(L,-1))
lua_pop(L,1);
return -1;
lua_pushnumber(L, 21); /* push 1st argument */
lua_pushnumber(L, 31); /* push 2nd argument */
/* do the call (2 arguments, 1 result) */
if (lua_pcall(L, 2, 1, 0) != 0) {
printf("error running function `f': %s\n",lua_tostring(L, -1));
return -1;
/* retrieve result */
if (!lua_isnumber(L, -1)) {
printf("function `f' must return a number\n");
return -1;
z = lua_tonumber(L, -1);
printf("Result: %f\n",z);
lua_pop(L, 1);
lua_close(L);
return 0;
function f (x, y)
return (x^2 * math.sin(y))/(1 - x)
end
---- How to execute a Lua Script from C.
#include "lua.h"
#include "lualib.h"
#include "lauxlib.h"
/* gcc -o luatest luatest.c -I/usr/local/include -L/usr/local/lib -llua -lm -ldl */
int main()
int s=0;
lua_State *L = lua_open();
// load the libs
luaL_openlibs(L);
//run a Lua scrip here
luaL_dofile(L,"foo.lua");
printf("\nAllright we are back in C.\n");
lua_close(L);
return 0;
io.write("Please enter your name: ")
name = io.read() -- read input from user
print ("Hi " .. name .. ", did you know we are in lua right now?")
---- How to get a Variable value from Lua to C.
#include <stdio.h>
#include <lua.h>
#include <lualib.h>
#include <lauxlib.h>
#include <string.h>
/* gcc -o test test.c -I/usr/local/include -L/usr/local/lib -llua -lm -ldl */
int main()
lua_State *L = lua_open();
if(luaL_loadfile(L,"settings.lua") || lua_pcall(L,0,0,0))
printf("Error failed to load %s",lua_tostring(L,-1));
else
lua_getglobal(L,"screenWidth");
const int screenWidth = lua_tonumber(L,-1);
printf("Screen Width = %d \n", screenWidth);
lua_getglobal(L,"appName");
const char *appName = luaL_checkstring(L, -1);
printf("Screen Name = %s \n", appName);
lua_close(L);
/* If we got this far, everything worked */
printf("Success!\n");
return 0;
appName = "Firefox"
screenWidth = 400
------ How to write a lua binding in C.
#include "lua.h"
#include "lualib.h"
#include "lauxlib.h"
#include <string.h>
/* gcc zstring.c -Wall -shared -o zstring.so */
static int zst_strlen(lua_State *L)
size_t len;
len = strlen(lua_tostring(L, 1));
lua_pushnumber(L, len);
return 1;
int luaopen_zstring(lua_State *L)
lua_register(L,"zst_strlen", zst_strlen);
return 0;
require "zstring"
print(zst_strlen("Hello, World"))
----- Another Binding Example
#include "lua.h"
#include "lualib.h"
#include "lauxlib.h"
#include <unistd.h>
#include <sys/stat.h>
#include <stdlib.h>
/* gcc general.c -Wall -shared -o general.so */
/* system */
static int zst_exec(lua_State *L)
int status;
status = system(lua_tostring(L, 1));
lua_pushnumber(L, status);
return 1;
/* mkdir */
static int zst_mkdir(lua_State *L)
int status;
mode_t mode = lua_tonumber(L, 2);
status = mkdir(lua_tostring(L, 1), mode);
lua_pushnumber(L, status);
return 1;
/* symlink */
static int zst_symlink(lua_State *L)
int status;
const char *old = lua_tostring(L, 1);
const char *new = lua_tostring(L, 2);
status = symlink(old, new);
lua_pushnumber(L, status);
return 1;
/* rmdir */
static int zst_rmdir(lua_State *L)
int status;
status = rmdir(lua_tostring(L, 1));
lua_pushnumber(L, status);
return 1;
/* rename */
static int zst_rename(lua_State *L)
int status;
const char *old = lua_tostring(L, 1);
const char *new = lua_tostring(L, 2);
status = rename(old, new);
lua_pushnumber(L, status);
return 1;
/* remove */
static int zst_remove(lua_State *L)
int status;
const char *filename = lua_tostring(L, 1);
status = remove(filename);
lua_pushnumber(L, status);
return 1;
/* chown */
static int zst_chown(lua_State *L)
int status;
const char *filename = lua_tostring(L, 1);
uid_t owner = lua_tonumber(L, 2);
gid_t group = lua_tonumber(L, 3);
status = chown(filename, owner, group);
lua_pushnumber(L, status);
return 1;
/* chmod */
static int zst_chmod(lua_State *L)
int status;
const char *filename = lua_tostring(L, 1);
mode_t mode = lua_tonumber(L, 2);
status = chmod(filename, mode);
lua_pushnumber(L, status);
return 1;
/* get_current_dir_name */
static int zst_getcwd(lua_State *L)
char *dir;
dir = get_current_dir_name();
lua_pushstring(L, dir);
return 1;
int luaopen_general(lua_State *L)
lua_register(L,"zst_exec", zst_exec);
lua_register(L,"zst_mkdir", zst_mkdir);
lua_register(L,"zst_symlink", zst_symlink);
lua_register(L,"zst_rmdir", zst_rmdir);
lua_register(L,"zst_rename", zst_rename);
lua_register(L,"zst_remove", zst_remove);
lua_register(L,"zst_chown", zst_chown);
lua_register(L,"zst_chmod", zst_chmod);
lua_register(L,"zst_getcwd", zst_getcwd);
return 0;
Ugggg lost all the formating in that.
If you cant make heads or tails of the above you can view it on my google code wiki http://code.google.com/p/zester/wiki/Lua_C
Last edited by zester (2011-09-13 18:20:07)

Learning Adobe Scripts Language

Dear Friends,
I would like to learn adobe scripting language. So I don't have exact root to learn.
Please advise me which l can be start at the basic things and what is the language used in adobe script.
Please let me know if some one have answer..
Thanks in advance..
Regards
Ganesh

You should take a look at this post in the Illustrator general forum…
http://forums.adobe.com/thread/771637?tstart=30
Much depends on what it is you want to script and your OS can make an impact too.

Your favourite shell / scripting language????

I am going to learn Scripting in Unix (mainly Solaris) . So i thought of asking you DBA gurus around the world what your favourite scripting language (Python, Perl,.. etc) is and your favourite Shell (csh,sh,ksh) . I found a similair post favourite shell / scripting language?
which was answered after two years(!!!) with only one reply. I guess i'll be lucky to get more than one perspective this time.

The way I remember it, having use these since 1983, is:
- Originally we had the Bourne Shell (/bin/sh), also known as 'Shell'
- Then came the C shell (/bin/csh) with real programming constructs.
- Then a number of programming capabilities were retrofit to Shell
- Then the Korn shell (/bin/ksh) was created to bring C shell capabilities to Shell
- Then a variant of the Korn Shell was placed in the public domain (/bin/pdksh)
- Then Bourne Again shell was created as a superset of Korn shell (/bin/bash)
Seems like a number of people say 'sh' when they mean 'BAsh'. In which case, there should be little advantage to going back to ksh. However, there are many advantages to going up to bash.
http://www.faqs.org/docs/linux_intro/x7132.html

Test Bench Scripting Language

Hi,
I am an intern at a company which is wanting me to create a scripting language and compiler that would be capable of controlling several instruments on their test bench through GPIB, as well as use the PXI-7833R to communicate to one of their devices over SPI. I would consider myself an intermediate LabVIEW user that has never really worked with any type of VI which involved parsing scripts or the like.
Is there any application other than LabVIEW that would be more suited for this type of application. I plan to have to use several dll's written in C++ to make things easier on myself, but I wasn't sure if I was trying to re-invent the wheel here or if there was something like this that had already been done that I could refer to.
Any help that anyone can give on this subject would be greatly appreciated! Thanks.

Thank you all for responding so quickly, all of your help is very appreciated. I will have to go through many of these languages to determine which option is going to be the best suited solution for this. Other than TestStand and Python I really have not heard of any of the others.
I have brought up the idea of using TestStand to the team that is going to be primarily using this application and they have said that many of them have no experience at all with LabVIEW and don't really feel comfortable with the idea of using something like that to do this. They all say that they would feel much more at home with a text based language that they can all pick up on easily. Which, obviously creates more work for me because I have to be able to document all of this so that it is easily to manipulate by others...
I am looking into the LuaVIEW interface right now, I will definitely look into all of the others later and let you all know how things are progressing. If anyone else has any other ideas for ways to make this easier I would greatly greatly appreciate it.
I have one more question which I will really just need once I get the parsing done. As I said in my first post I will be using an FPGA for communicating with a device that will be constantly relaying information back from an A/D. In order to conserve space on the FPGA I am thinking of somehow parsing the code in a way that the commands that only concern the GPIB instruments will be run from the host VI and the code for communcating with the device will be loaded onto the FPGA Target VI. Does this sound like the best way to go about this and do you have any ideas for how to do the separation?
Thank you,
Tyler

Acrobat distiller 8.0 post script

Hello -
we currently updated our adobe7 to adobe 8 professional, and we have a distiller that we put in a "watch folder" where it would PDF"s all our tables ... after the updated to 8.0 the post script no longer works... can someone explain to me what we need to change or do to get this to work again...
attached the scrip below... I appreciate any input
% PostScript program for distilling and combining multiple PostScript files.
% When embedding font subsets, it is highly recommended you use this technique
% to distill multiple PS files so only one font subset is used for each font.
/prun { /mysave save def % Performs a save before running the PS file
dup = flush % Shows name of PS file being run
RunFile % Calls built in Distiller procedure
clear cleardictstack % Cleans up after PS file
mysave restore % Restores save level
} def
(//sqlf1/test/Applications/web/products/out/highlite.prn) prun
(//sqlf1/test/Applications/web/products/out/table01.prn) prun
(//sqlf1/test/Applications/web/products/out/table02.prn) prun
(//sqlf1/test/Applications/web/products/out/figure01.prn) prun
(//sqlf1/test/Applications/web/products/out/table03.prn) prun
(//sqlf1/test/Applications/web/products/out/figure03.prn) prun
(//sqlf1/test/Applications/web/products/out/table04.prn) prun
(//sqlf1/test/Applications/web/products/out/figure04.prn) prun
(//sqlf1/test/Applications/web/products/out/table05.prn) prun
(//sqlf1/test/Applications/web/products/out/figure05.prn) prun
(//sqlf1/test/Applications/web/products/out/table06.prn) prun
(//sqlf1/test/Applications/web/products/out/figure06.prn) prun
(//sqlf1/test/Applications/web/products/out/table07.prn) prun
(//sqlf1/test/Applications/web/products/out/figure07.prn) prun
(//sqlf1/test/Applications/web/products/out/table08.prn) prun
(//sqlf1/test/Applications/web/products/out/table09.prn) prun
(//sqlf1/test/Applications/web/products/out/table10.prn) prun
(//sqlf1/test/Applications/web/products/out/table11a.prn) prun
(//sqlf1/test/Applications/web/products/out/table11b.prn) prun
(//sqlf1/test/Applications/web/products/out/table11c.prn) prun
(//sqlf1/test/Applications/web/products/out/table11d.prn) prun
(//sqlf1/test/Applications/web/products/out/table11e.prn) prun
(//sqlf1/test/Applications/web/products/out/table11f.prn) prun
(//sqlf1/test/Applications/web/products/out/table11g.prn) prun
(//sqlf1/test/Applications/web/products/out/table11h.prn) prun
(//sqlf1/test/Applications/web/products/out/table12.prn) prun
(//sqlf1/test/Applications/web/products/out/table13.prn) prun
(//sqlf1/test/Applications/web/products/out/table14.prn) prun
(//sqlf1/test/Applications/web/products/out/figure11.prn) prun
(//sqlf1/test/Applications/web/products/out/table15.prn) prun
(//sqlf1/test/Applications/web/products/out/table16.prn) prun
(//sqlf1/test/Applications/web/products/out/table17a.prn) prun
(//sqlf1/test/Applications/web/products/out/table17b.prn) prun
% (//sqlf1/test/Applications/web/products/out/tableb1.prn) prun
% (//sqlf1/test/Applications/web/products/out/tablec1.prn) prun
% (//sqlf1/test/Applications/web/products/out/tablec2.prn) prun
% (//sqlf1/test/Applications/web/products/out/figc1_c2.prn) prun
% (//sqlf1/test/Applications/web/products/out/tablec3.prn) prun
% (//sqlf1/test/Applications/web/products/out/tablec4.prn) prun
% (//sqlf1/test/Applications/web/products/out/figc3_c4.prn) prun
(//sqlf1/test/Applications/web/products/out/tableh1.prn) prun
% INSTRUCTIONS
% 1. Locate all PostScript files to be distilled.
% 2. Make a copy of this file and give it the name you want to have as the prefix
% for the resulting file. For example, you could name this file MyBook.ps.
% 3. Include a line for each PostScript file to be run using the pathname syntax
% appropriate for the platform running Acrobat Distiller.
% Macintosh pathname synta

Helge,
I have Acrobat-Distiller 9 Pro on Mac Leopard.
1) If I use Distiller directly, it will show "pstack flush" messages as well as error messages
in its own window.
2) If I use Distiller via Acrobat and there are no problems, I can't see "pstack flush" messages at all.
3) If I use Distiller via Acrobat and there is a problem, I get error messages AND
"pstack flush" messages in a TextEdit window.
Its header tells me about a log file but I can't find the logfile.
Perhaps I am too new to Acrobat 9, and need some experimenting with its setup.
Miklos

Argo and scripting languages

Sorry for the invisibility cloak I have been wearing here lately. We had an intention to release this a lot earlier, but bureaucracy got the best of us. But at last ...
Please visit https://www.sdn.sap.com/irj/sdn/downloaditem?rid=/webcontent/uuid/d8965f54-0c01-0010-e0bf-d8cce7a59b0c">https [original link is broken] [original link is broken]. BTW, someone has already built their own Argo Yahoo! widget to search SDN.
You can visit the Argo forum here Enterprise Search for more of an explanation of what Argo is and how it can be useful. FWIW, we expect to have Argo interfaces for e-mail, SMS, natural language, native mobile clients, WebDynpro, Yahoo! Widgets, Mac Widgets, Vista Gadgets, Google Maps, and much more. And we expect some of you to contribute some of this great stuff.
Let us know what you think on the Argo forum, but a little bit of cross-posting here probably would be a good thing.
Thanks ...

MonarchVotetech wrote:
Also, not trying to be rude here. I am not looking for "why are you doing this" or "do something else" type of changing directions type of responses. Basically, I am interested in this thing in and of itself.Sorry, but since you can't always get what you want, I have to say this: have you looked into Groovy? It may give you what you want -- a powerful scripting language that can integrate closely with java (I think). Another scripting language to look at is Jython which I believe can be integrated with java. No JNI needed.
Good luck
Pete

Post script Language Level 2 or 3 ?

Similar Messages

Maybe you are looking for