SCCM 2012 SP1 - Offline Servicing failure - Failed to find or access the update binaries to be applied on the image
Hi there
Trying to patch a new Windows 7 SP1 image within SCCM 2012 SP1, but it's failing.
I've searched for information on the failure messages I am seeing, but although there is a LOT of information online concerning Offline Servicing failures, I can't find anything on the errors I am seeing.
I've tried injecting a single update, five updates and ten updates, no difference, same messages.
We have McAfee Access Protection disabled, as we know Offline Servicing simply won't work if this is running.
In the console, in Schedule Update Status for the image I am trying to update, the following message is shown:
"Failed to find or access the update binaries to be applied on the image."
That sounds as if the process can't find the actual .cab file for any update I've tried to inject, but I don't know why it wouldn't be able to do that, we have Software Updates configured and the .cab files are on the same server.
When I looked at the OfflineServicingMgr.log file, I see the following entries:
Processing image at index 1 SMS_OFFLINE_SERVICING_MANAGER 14/06/2014 14:52:49 8272 (0x2050)
Mounting image at index 1. Image file='D:\ConfigMgr_OfflineImageServicing\PackageID\W7_Image.wim', MountDirectory='D:\ConfigMgr_OfflineImageServicing\PackageID\ImageMountDir', ImageFileType='WIM', Mode='ReadWrite' SMS_OFFLINE_SERVICING_MANAGER
14/06/2014 14:52:49 8272 (0x2050)
Image OS information : MajorVersionMS = 6, MinorVersionMS = 1, MajorVersionLS = 7601, MinorVersionLS = 17514 SMS_OFFLINE_SERVICING_MANAGER 14/06/2014 14:53:31
8272 (0x2050)
Failed to find properties of file 4 SMS_OFFLINE_SERVICING_MANAGER 14/06/2014 14:53:31 8272 (0x2050)
UnMounting Image (Commit Changes = 0) ... SMS_OFFLINE_SERVICING_MANAGER 14/06/2014 14:53:31 8272 (0x2050)
Completed processing image package PackageID. Status = Failed SMS_OFFLINE_SERVICING_MANAGER 14/06/2014 14:54:04 8272 (0x2050)
Updated history for image package PackageID in the database SMS_OFFLINE_SERVICING_MANAGER 14/06/2014 14:54:04 8272 (0x2050)
Schedule processing failed SMS_OFFLINE_SERVICING_MANAGER 14/06/2014 14:54:04 8272 (0x2050)
Processing completed for Schedule with ID 16777237 SMS_OFFLINE_SERVICING_MANAGER 14/06/2014 14:54:04 8272 (0x2050)
STATMSG: ID=7910 SEV=E LEV=M SOURCE="SMS Server" COMP="SMS_OFFLINE_SERVICING_MANAGER" SYS=SCCMServer.domain SITE=Site_Code PID=8560 TID=8272 GMTDATE=Sat Jun 14 13:54:04.964 2014 ISTR0="16777237" ISTR1="" ISTR2=""
ISTR3="" ISTR4="" ISTR5="" ISTR6="" ISTR7="" ISTR8="" ISTR9="" NUMATTRS=0 SMS_OFFLINE_SERVICING_MANAGER
14/06/2014 14:54:04 8272 (0x2050)
Schedule processing thread stopped SMS_OFFLINE_SERVICING_MANAGER 14/06/2014 14:54:05 8272 (0x2050)
I'm not sure what file "Failed to find properties of file 4" is referring to, whether dism.exe, an update or the image itself, but immediately after this message appears the image is unmounted. After that this message shows:
"Completed processing image package PackageID. Status = Failed"
As I say, there's a lot of information available re Offline Servicing but I haven't found anything with these particular messages.
If anyone has encountered this before, I'd appreciate any information you have.
Regards,
John.
Hi,
I think file named 'NO_SMS_ON_DRIVE.SMS’ might be causing this issue. If this file is present in logical drives, then please give it a shot one more time after deleting this file from the logical drives.
Due to this file, it might be preventing 'smsexec' service to skip the drive when looking for content. So worth a try!
After deleting this file, you also need to restart 'smsexec' service to reflect the changes. You can also verify from below registry value & ensure that all of your logical drives (specially where SCCMContentLib directory resides) should be listed
over there
'HKLM\Software\Microsoft\SMS\DP\ContentLibUsableDrives'
Hope this will help!
Cheers | Navdeep Sidhu
Similar Messages
-
SCCM 2012 SP1 MDT task sequence fails on reboot does not retain ip
we are having a sccm 2012 sp1 server that used for installation of win 8.1 Enterprise , the task sequence works perfectly fine but when we run the same task on HP Elite 8300 system having Intel 82579LM Adapter from Windows XP , after the reboot the
task fails as no ip address is assigned the NIC , We did download the WInPE Adapter drivers from HP site and injecting to the x86 Boot Image (6.2.9200) however the task still fails ,
Our environment uses all static ip address , the same task as mentioned earlier has worked fine with Different brands of HP elite 8200/8100 , infact the elite 8200 also uses the same NIC card
Find below the smsts.log file
Main error in the log file is
No physical network adapters found OSDNetSettings 2/12/2014 1:02:38 AM 2064 (0x0810)
Found network adapter "Intel(R) 82579LM Gigabit Network Connection" with IP Address 169.254.181.151. TSMBootstrap 2/12/2014 1:05:41 PM 1984 (0x07C0)
Xtract from LOG
SMSTSRebootDelay=60 Reboot 2/12/2014 1:01:56 AM 3496 (0x0DA8)
SMSTSRebootMessage=A new Microsoft Windows operating system is being installed. The computer must restart to continue. Reboot 2/12/2014 1:01:56 AM 3496 (0x0DA8)
SMSTSRebootRequested=WinPE Reboot 2/12/2014 1:01:56 AM 3496 (0x0DA8)
Process completed with exit code 0 TSManager 2/12/2014 1:01:56 AM 1876 (0x0754)
!--------------------------------------------------------------------------------------------! TSManager 2/12/2014 1:01:56 AM 1876 (0x0754)
Successfully completed the action (Restart to Windows PE) with the exit win32 code 0 TSManager 2/12/2014 1:01:56 AM 1876 (0x0754)
Set authenticator in transport TSManager 2/12/2014 1:01:56 AM 1876 (0x0754)
Set a global environment variable _SMSTSLastActionRetCode=0 TSManager 2/12/2014 1:01:57 AM 1876 (0x0754)
Set a global environment variable _SMSTSLastActionSucceeded=true TSManager 2/12/2014 1:01:57 AM 1876 (0x0754)
Clear local default environment TSManager 2/12/2014 1:01:57 AM 1876 (0x0754)
Updated security on object E:\_SMSTaskSequence. TSManager 2/12/2014 1:01:57 AM 1876 (0x0754)
Set a global environment variable _SMSTSNextInstructionPointer=59 TSManager 2/12/2014 1:01:57 AM 1876 (0x0754)
Set a TS execution environment variable _SMSTSNextInstructionPointer=59 TSManager 2/12/2014 1:01:57 AM 1876 (0x0754)
Set a global environment variable _SMSTSInstructionStackString=0 41 57 TSManager 2/12/2014 1:01:57 AM 1876 (0x0754)
Set a TS execution environment variable _SMSTSInstructionStackString=0 41 57 TSManager 2/12/2014 1:01:57 AM 1876 (0x0754)
Save the current environment block TSManager 2/12/2014 1:01:57 AM 1876 (0x0754)
Executing command line: "bcdedit.exe" TSManager 2/12/2014 1:01:57 AM 1876 (0x0754)
CreateProcess failed. Code(0x80070002) TSManager 2/12/2014 1:01:57 AM 1876 (0x0754)
Command line execution failed (80070002) TSManager 2/12/2014 1:01:57 AM 1876 (0x0754)
Staging boot image UNB0003A TSManager 2/12/2014 1:01:57 AM 1876 (0x0754)
ResolveSource flags: 0x00000000 TSManager 2/12/2014 1:01:59 AM 1876 (0x0754)
SMSTSPersistContent: . The content for package UNB0003A will be persisted TSManager 2/12/2014 1:01:59 AM 1876 (0x0754)
Set authenticator in transport TSManager 2/12/2014 1:01:59 AM 1876 (0x0754)
WinHttp credentials set TSManager 2/12/2014 1:01:59 AM 1876 (0x0754)
List of files to be downloaded TSManager 2/12/2014 1:01:59 AM 1876 (0x0754)
Downloaded file from http://unb-ho-sccmdb.exch1.mas.unb.com:80/SMS_DP_SMSPKG$/UNB0003A/sccm?/WinPE.UNB0003A.wim to E:\_SMSTaskSequence\Packages\UNB0003A\WinPE.UNB0003A.wim TSManager 2/12/2014 1:02:22 AM 1876
(0x0754)
VerifyContentHash: Hash algorithm is 32780 TSManager 2/12/2014 1:02:22 AM 1876 (0x0754)
Found boot image E:\_SMSTaskSequence\Packages\UNB0003A\WinPE.UNB0003A.wim TSManager 2/12/2014 1:02:25 AM 1876 (0x0754)
Copying boot image locally... TSManager 2/12/2014 1:02:25 AM 1876 (0x0754)
Failed to find ADK installation root registry key TSManager 2/12/2014 1:02:32 AM 1876 (0x0754)
Opening image file E:\_SMSTaskSequence\WinPE\sources\boot.wim TSManager 2/12/2014 1:02:32 AM 1876 (0x0754)
Applying image 1 to volume E:\_SMSTaskSequence\WinPE TSManager 2/12/2014 1:02:32 AM 1876 (0x0754)
Closing image file E:\_SMSTaskSequence\WinPE\sources\boot.wim TSManager 2/12/2014 1:02:35 AM 1876 (0x0754)
Capturing WinPE bootstrap settings TSManager 2/12/2014 1:02:35 AM 1876 (0x0754)
Environment scope successfully created: Global\{E7E5BB69-6198-4555-B5CA-6C46A2B5EB78} TSManager 2/12/2014 1:02:35 AM 1876 (0x0754)
Executing command line: "osdnetsettings.exe" capture adapters:true scope:Global\{E7E5BB69-6198-4555-B5CA-6C46A2B5EB78} TSManager 2/12/2014 1:02:35 AM 1876 (0x0754)
==============================[ OSDNetSettings.exe ]=========================== OSDNetSettings 2/12/2014 1:02:36 AM 2064 (0x0810)
Command line: "osdnetsettings.exe" capture adapters:true scope:Global\{E7E5BB69-6198-4555-B5CA-6C46A2B5EB78} OSDNetSettings 2/12/2014 1:02:36 AM 2064 (0x0810)
No adapters found with non-empty DNSDomainSuffixSearchOrder OSDNetSettings 2/12/2014 1:02:36 AM 2064 (0x0810)
Adapter "ROOT\SYMC_TEEFER2MP\0000" not found OSDNetSettings 2/12/2014 1:02:38 AM 2064 (0x0810)
No physical network adapters found OSDNetSettings 2/12/2014 1:02:38 AM 2064 (0x0810)
OSDNetSettings finished: 0x00000000 OSDNetSettings 2/12/2014 1:02:38 AM 2064 (0x0810)
Process completed with exit code 0 TSManager 2/12/2014 1:02:38 AM 1876 (0x0754)
Installing boot image to hard drive TSManager 2/12/2014 1:02:38 AM 1876 (0x0754)
Backing up existing boot system before trying to set up new boot system TSManager 2/12/2014 1:02:38 AM 1876 (0x0754)
BootLoader::backup: C:\, E:\_SMSTaskSequence\backup TSManager 2/12/2014 1:02:39 AM 1876 (0x0754)
BootLoader::restore: E:\_SMSTaskSequence\WinPE, C:\ TSManager 2/12/2014 1:02:43 AM 1876 (0x0754)
Saving bcd store to E:\_SMSTaskSequence\WinPE\boot\BCD TSManager 2/12/2014 1:02:43 AM 1876 (0x0754)
Executing command line: "E:\_SMSTaskSequence\WinPE\SMS\bin\i386\bootsect.exe" /NT60 SYS /MBR TSManager 2/12/2014 1:02:45 AM 1876 (0x0754)
Process completed with exit code 0 TSManager 2/12/2014 1:02:46 AM 1876 (0x0754)
Updated security on object E:\_SMSTaskSequence. TSManager 2/12/2014 1:02:47 AM 1876 (0x0754)
Set a global environment variable _SMSTSNextInstructionPointer=59 TSManager 2/12/2014 1:02:47 AM 1876 (0x0754)
Set a TS execution environment variable _SMSTSNextInstructionPointer=59 TSManager 2/12/2014 1:02:47 AM 1876 (0x0754)
Set a global environment variable _SMSTSInstructionStackString=0 41 57 TSManager 2/12/2014 1:02:47 AM 1876 (0x0754)
Set a TS execution environment variable _SMSTSInstructionStackString=0 41 57 TSManager 2/12/2014 1:02:47 AM 1876 (0x0754)
Save the current environment block TSManager 2/12/2014 1:02:47 AM 1876 (0x0754)
Updated security on object C:\_SMSTSVolumeID.7159644d-f741-45d5-ab29-0ad8aa4771ca. TSManager 2/12/2014 1:02:47 AM 1876 (0x0754)
Updated security on object D:\_SMSTSVolumeID.7159644d-f741-45d5-ab29-0ad8aa4771ca. TSManager 2/12/2014 1:02:47 AM 1876 (0x0754)
Updated security on object E:\_SMSTSVolumeID.7159644d-f741-45d5-ab29-0ad8aa4771ca. TSManager 2/12/2014 1:02:47 AM 1876 (0x0754)
Updated security on object E:\_SMSTaskSequence. TSManager 2/12/2014 1:02:47 AM 1876 (0x0754)
Set a global environment variable _SMSTSNextInstructionPointer=59 TSManager 2/12/2014 1:02:47 AM 1876 (0x0754)
Set a TS execution environment variable _SMSTSNextInstructionPointer=59 TSManager 2/12/2014 1:02:47 AM 1876 (0x0754)
Set a global environment variable _SMSTSInstructionStackString=0 41 57 TSManager 2/12/2014 1:02:47 AM 1876 (0x0754)
Set a TS execution environment variable _SMSTSInstructionStackString=0 41 57 TSManager 2/12/2014 1:02:47 AM 1876 (0x0754)
Save the current environment block TSManager 2/12/2014 1:02:47 AM 1876 (0x0754)
Expand a string: %_SMSTSMDataPath%\Logs TSManager 2/12/2014 1:02:47 AM 1876 (0x0754)
<![LOG[LOGGING: Finalize process ID set to 780]LOG]!><time="01:04:01.537+480" date="02-12-2014" component="TSBootShell" context="" type="1" thread="784" file="tslogging.cpp:1495">
1/1/1601 12:00:00 AM 1995266923 (0x76ED5B6B)
==============================[ TSBootShell.exe ]============================== TSBootShell 2/12/2014 1:04:01 AM 784 (0x0310)
Succeeded loading resource DLL 'X:\sms\bin\i386\1033\TSRES.DLL' TSBootShell 2/12/2014 1:04:01 AM 784 (0x0310)
Debug shell is enabled TSBootShell 2/12/2014 1:04:01 AM 784 (0x0310)
Waiting for PNP initialization... TSBootShell 2/12/2014 1:04:01 AM 796 (0x031C)
RAM Disk Boot Path: MULTI(0)DISK(0)RDISK(0)PARTITION(3)\_SMSTASKSEQUENCE\WINPE\SOURCES\BOOT.WIM TSBootShell 2/12/2014 1:04:01 AM 796 (0x031C)
WinPE boot path: E:\_SMSTASKSEQUENCE\WINPE\SOURCES\BOOT.WIM TSBootShell 2/12/2014 1:04:01 AM 796 (0x031C)
Booted from fixed disk TSBootShell 2/12/2014 1:04:01 AM 796 (0x031C)
Found config path E:\_SMSTaskSequence TSBootShell 2/12/2014 1:04:01 AM 796 (0x031C)
hMap != 0, HRESULT=80070002 (e:\nts_sccm_release\sms\framework\tscore\environmentscope.cpp,515) TSBootShell 2/12/2014 1:04:01 AM 796 (0x031C)
m_pGlobalScope->open(), HRESULT=80070002 (e:\nts_sccm_release\sms\framework\tscore\environmentlib.cpp,337) TSBootShell 2/12/2014 1:04:01 AM 796 (0x031C)
this->open(), HRESULT=80070002 (e:\nts_sccm_release\sms\framework\tscore\environmentlib.cpp,549) TSBootShell 2/12/2014 1:04:01 AM 796 (0x031C)
hMap != 0, HRESULT=80070002 (e:\nts_sccm_release\sms\framework\tscore\environmentscope.cpp,515) TSBootShell 2/12/2014 1:04:01 AM 796 (0x031C)
m_pGlobalScope->open(), HRESULT=80070002 (e:\nts_sccm_release\sms\framework\tscore\environmentlib.cpp,337) TSBootShell 2/12/2014 1:04:01 AM 796 (0x031C)
this->open(), HRESULT=80070002 (e:\nts_sccm_release\sms\framework\tscore\environmentlib.cpp,549) TSBootShell 2/12/2014 1:04:01 AM 796 (0x031C)
hMap != 0, HRESULT=80070002 (e:\nts_sccm_release\sms\framework\tscore\environmentscope.cpp,515) TSBootShell 2/12/2014 1:04:01 AM 796 (0x031C)
m_pGlobalScope->open(), HRESULT=80070002 (e:\nts_sccm_release\sms\framework\tscore\environmentlib.cpp,337) TSBootShell 2/12/2014 1:04:01 AM 796 (0x031C)
open(), HRESULT=80070002 (e:\nts_sccm_release\sms\framework\tscore\environmentlib.cpp,430) TSBootShell 2/12/2014 1:04:01 AM 796 (0x031C)
Can not find DeploymentType in file TsmBootstrap.ini or the file doesn't exist. This is not running on Windows To Go. TSBootShell 2/12/2014 1:04:01 AM 796 (0x031C)
hMap != 0, HRESULT=80070002 (e:\nts_sccm_release\sms\framework\tscore\environmentscope.cpp,515) TSBootShell 2/12/2014 1:04:01 AM 796 (0x031C)
m_pGlobalScope->open(), HRESULT=80070002 (e:\nts_sccm_release\sms\framework\tscore\environmentlib.cpp,337) TSBootShell 2/12/2014 1:04:01 AM 796 (0x031C)
open(), HRESULT=80070002 (e:\nts_sccm_release\sms\framework\tscore\environmentlib.cpp,430) TSBootShell 2/12/2014 1:04:01 AM 796 (0x031C)
Restoring boot system from E:\_SMSTaskSequence\backup TSBootShell 2/12/2014 1:04:01 AM 796 (0x031C)
Successfully loaded the BCD boot system TSBootShell 2/12/2014 1:04:05 AM 796 (0x031C)
Successfully loaded an exported NTLDR boot system TSBootShell 2/12/2014 1:04:05 AM 796 (0x031C)
BootLoader::restore: E:\_SMSTaskSequence\backup, C:\ TSBootShell 2/12/2014 1:04:05 AM 796 (0x031C)
Successfully merged logs from cache. TSBootShell 2/12/2014 1:04:06 AM 796 (0x031C)
hMap != 0, HRESULT=80070002 (e:\nts_sccm_release\sms\framework\tscore\environmentscope.cpp,515) TSBootShell 2/12/2014 1:04:06 AM 796 (0x031C)
m_pGlobalScope->open(), HRESULT=80070002 (e:\nts_sccm_release\sms\framework\tscore\environmentlib.cpp,337) TSBootShell 2/12/2014 1:04:06 AM 796 (0x031C)
open(), HRESULT=80070002 (e:\nts_sccm_release\sms\framework\tscore\environmentlib.cpp,430) TSBootShell 2/12/2014 1:04:06 AM 796 (0x031C)
Loading bootstrap settings from E:\_SMSTaskSequence\WinPE TSBootShell 2/12/2014 1:04:06 AM 796 (0x031C)
Loading saved WinPE settings TSBootShell 2/12/2014 1:04:06 AM 796 (0x031C)
Creating key 'Software\Microsoft\SMS\47006C006F00620061006C005C007B00450037004500350042004200360039002D0036003100390038002D0034003500350035002D0042003500430041002D003600430034003600410032004200350045004200370038007D00' TSBootShell
2/12/2014 1:04:06 AM 796 (0x031C)
Environment scope successfully created: Global\{E7E5BB69-6198-4555-B5CA-6C46A2B5EB78} TSBootShell 2/12/2014 1:04:06 AM 796 (0x031C)
Configuring WinPE bootstrap settings TSBootShell 2/12/2014 1:04:06 AM 796 (0x031C)
Creating WinPE answer file TSBootShell 2/12/2014 1:04:06 AM 796 (0x031C)
Setting hive location to "X:\windows\system32" TSBootShell 2/12/2014 1:04:06 AM 796 (0x031C)
Getting namespace "Microsoft-Windows-Setup" for architecture "x86" TSBootShell 2/12/2014 1:04:06 AM 796 (0x031C)
Configuring global network settings TSBootShell 2/12/2014 1:04:06 AM 796 (0x031C)
Join type: TSBootShell 2/12/2014 1:04:06 AM 796 (0x031C)
DNS domain: exch1.mas.unb.com TSBootShell 2/12/2014 1:04:06 AM 796 (0x031C)
DNS domain search order: TSBootShell 2/12/2014 1:04:06 AM 796 (0x031C)
IP filter sec enabled: false TSBootShell 2/12/2014 1:04:06 AM 796 (0x031C)
No adapters found in environment. Performing global configuration only. TSBootShell 2/12/2014 1:04:06 AM 796 (0x031C)
Writing configuration information to E:\_SMSTaskSequence\WinPE\WinPeUnattend.xml TSBootShell 2/12/2014 1:04:06 AM 796 (0x031C)
Successfully saved configuration information to E:\_SMSTaskSequence\WinPE\WinPeUnattend.xml TSBootShell 2/12/2014 1:04:06 AM 796 (0x031C)
Executing command line: wpeinit.exe -winpe TSBootShell 2/12/2014 1:04:06 AM 796 (0x031C)
The command completed successfully. TSBootShell 2/12/2014 1:05:40 AM 796 (0x031C)
Starting DNS client service. TSBootShell 2/12/2014 1:05:40 AM 796 (0x031C)
Finalizing network settings TSBootShell 2/12/2014 1:05:40 AM 796 (0x031C)
No adapters found in environment. Performing global finalization only. TSBootShell 2/12/2014 1:05:40 AM 796 (0x031C)
Finalizing global network settings TSBootShell 2/12/2014 1:05:40 AM 796 (0x031C)
DNS domain: exch1.mas.unb.com TSBootShell 2/12/2014 1:05:40 AM 796 (0x031C)
DNS domain search order: TSBootShell 2/12/2014 1:05:40 AM 796 (0x031C)
DNS for WINS enabled: false TSBootShell 2/12/2014 1:05:40 AM 796 (0x031C)
LMHosts file enabled: true TSBootShell 2/12/2014 1:05:40 AM 796 (0x031C)
Host lookup file: TSBootShell 2/12/2014 1:05:40 AM 796 (0x031C)
WINS scope ID: TSBootShell 2/12/2014 1:05:40 AM 796 (0x031C)
Executing command line: X:\sms\bin\i386\TsmBootstrap.exe /env:WinPE /configpath:E:\_SMSTaskSequence TSBootShell 2/12/2014 1:05:40 AM 796 (0x031C)
The command completed successfully. TSBootShell 2/12/2014 1:05:40 AM 796 (0x031C)
==============================[ TSMBootStrap.exe ]============================== TSMBootstrap 2/12/2014 1:05:40 AM 1984 (0x07C0)
Command line: X:\sms\bin\i386\TsmBootstrap.exe /env:WinPE /configpath:E:\_SMSTaskSequence TSMBootstrap 2/12/2014 1:05:40 AM 1984 (0x07C0)
Succeeded loading resource DLL 'X:\sms\bin\i386\1033\TSRES.DLL' TSMBootstrap 2/12/2014 1:05:40 AM 1984 (0x07C0)
Succeeded loading resource DLL 'X:\sms\bin\i386\TSRESNLC.DLL' TSMBootstrap 2/12/2014 1:05:40 AM 1984 (0x07C0)
Adding SMS bin folder "X:\sms\bin\i386" to the system environment PATH TSMBootstrap 2/12/2014 1:05:40 AM 1984 (0x07C0)
Failed to open PXE registry key. Not a PXE boot. TSMBootstrap 2/12/2014 1:05:40 AM 1984 (0x07C0)
Resuming Task Sequence in WinPE TSMBootstrap 2/12/2014 1:05:40 AM 1984 (0x07C0)
Creating key 'Software\Microsoft\SMS\47006C006F00620061006C005C007B00350031004100300031003600420036002D0046003000440045002D0034003700350032002D0042003900370043002D003500340045003600460033003800360041003900310032007D00' TSMBootstrap
2/12/2014 1:05:40 AM 1984 (0x07C0)
Environment scope successfully created: Global\{51A016B6-F0DE-4752-B97C-54E6F386A912} TSMBootstrap 2/12/2014 1:05:40 AM 1984 (0x07C0)
Creating key 'Software\Microsoft\SMS\47006C006F00620061006C005C007B00420041003300410033003900300030002D0043004100360044002D0034006100630031002D0038004300320038002D003500300037003300410046004300320032004200300033007D00' TSMBootstrap
2/12/2014 1:05:40 AM 1984 (0x07C0)
Environment scope successfully created: Global\{BA3A3900-CA6D-4ac1-8C28-5073AFC22B03} TSMBootstrap 2/12/2014 1:05:40 AM 1984 (0x07C0)
Loading the Task Sequencing Environment from "E:\_SMSTaskSequence\TSEnv.dat". TSMBootstrap 2/12/2014 1:05:41 AM 1984 (0x07C0)
Updating the local data path in the Task Sequencing Environment. TSMBootstrap 2/12/2014 1:05:41 AM 1984 (0x07C0)
Setting LogMaxSize to 1000000 TSMBootstrap 2/12/2014 1:05:41 AM 1984 (0x07C0)
Setting LogMaxHistory to 1 TSMBootstrap 2/12/2014 1:05:41 AM 1984 (0x07C0)
Setting LogLevel to 0 TSMBootstrap 2/12/2014 1:05:41 AM 1984 (0x07C0)
Setting LogEnabled to 1 TSMBootstrap 2/12/2014 1:05:41 AM 1984 (0x07C0)
Setting LogDebug to 1 TSMBootstrap 2/12/2014 1:05:41 AM 1984 (0x07C0)
Command line for extension .exe is "%1" %* TSMBootstrap 2/12/2014 1:05:41 AM 1984 (0x07C0)
Set command line: "X:\sms\bin\i386\TsProgressUI.exe" /Register:WinPE TSMBootstrap 2/12/2014 1:05:41 AM 1984 (0x07C0)
Executing command line: "X:\sms\bin\i386\TsProgressUI.exe" /Register:WinPE TSMBootstrap 2/12/2014 1:05:41 AM 1984 (0x07C0)
==========[ TsProgressUI started in process 2004 ]========== TsProgressUI 2/12/2014 1:05:41 AM 2008 (0x07D8)
Command line: "X:\sms\bin\i386\TsProgressUI.exe" /Register:W
In dire need of help,
I have already gone through the below articles on the NET
http://social.technet.microsoft.com/Forums/systemcenter/en-US/0fe5cded-51cf-487a-97e3-837fb3426a3e/install-software-updates-in-osd-reboots-leaves-clients-in-provisioning-mode?forum=configmgrosd
http://social.technet.microsoft.com/Forums/systemcenter/en-US/c590e486-d3ca-423f-8953-e596160f3567/updates-hang-during-osd-kb2509007-not-working-for-me?forum=configmgrosd
Awating response,
Hasan RezaWell Finally I sorted my issue ,
Just want to share the solution, may be it would be helpful to some one else and save some times
The problem was that the Xp images has lot of hidden NIC installed , this would not allow the system to work with the correct NIC card and Ip address (System -> View Hidden Devices) , what I did 2 things
1) Copied the OSD Script folder from the SCCM Server to the Client pc and ran that ztigather.wsf and captured the output , it was evident that it showed capturing multiple adapters , (There are some blogs that pointed out that OSD can capture only one nic
due to the only one Adapter0 section being defined in the ZTIgather.xml file,)
2) I open the registry at the xp pc navigated to HKLM-> System ->Current Control Set-> Services-> TCPIP -> Parameters-> Interfaces ->
Expect for the NIC card that had the Ip address assigned I deleted all other nic card's guid,
As then post running deleting the old scanstate (USMTUTIL /rd c:\statestore) , reran the task and VOILA..
All worked fine , below are the two post I followed , though notvery relevant but they were helpful and help me reached the conclusion.
Thanks,
Hasan Reza.
http://systemscenter.ru/mdt2012.en/ztigatherwsf.htm
http://social.technet.microsoft.com/Forums/windowsserver/en-US/8acb7cd1-7028-4ffe-86c9-eb43041cf8b3/how-do-i-get-rid-of-second-169254xx-ipv4-address-on-windows-server-2008-sp2-x86?forum=winservergen -
SCCM 2012 SP1 - R2 Upgrade Incl Windows ADK for Windows 8.1 Update
Hi All
I Need some advice
We are preparing for the upgrade SCCM 2012 SP1 -> SCCM 2012 R2
Quick steps:
1 Uninstall ADK 8.0
2 Install ADK 8.1
3 Upgrade SCCM 2012 SP1 -> SCCM 2012 R2
4 Install CU1 SCCM 2012 R2
5 Upgrade Clients to SCCM 2012 R2
6 Upgrade Clients to SCCM 2012 R2 CU1 with WSUS (SCUP)
But today I read the following article
http://blogs.technet.com/b/configmgrteam/archive/2014/04/03/understanding-the-adk-for-windows-8-1-update-and-configmgr-osd.aspx
How does this update fit in the upgrade process (add step 7 and install this update on the SCCM Server) , or is it better to leave this update because windows PE5.1 is not supported yet.
I hope someone can give me some good advice
regards and thx in advance
JohanHi All
So I can also use the ADK 8.1 Update with the installation , so my quick steps will be than for the upgrade SCCM 2012 SP1 -> SCCM 2012 R2
1 Uninstall ADK 8.0
2 Install the ADK 8.1 UPDATE
3 Upgrade SCCM 2012 SP1 -> SCCM 2012 R2
4 Install CU1 SCCM 2012 R2
5 Upgrade Clients to SCCM 2012 R2
6 Upgrade Clients to SCCM 2012 R2 CU1 with WSUS (SCUP)
Regards
Johan -
SCCM 2012 R2 Offline Servicing with Older Updates
We use to run Windows 7 Pro 32/64 Bit but we are upgrading to Windows 7 Enterprise 64Bit for BitLocker option on our machines.
I perform offline servicing on my reference build and capture .wim image but for some reason I still have to install over 100 updates. For example it will not install Windows 7 x64 SP1 and IE10.
I performed a search of Windows Updates Released on or after April 2011, downloaded the files to a new folder/group "Old Windows 7 Updates". I perform another "Schedule Updates" on the .wim file, still does not install the older updates.
I saw a post talking about using DISM to force the older updates on the image but that fails for me as I am beginner for using DISM.
Any suggestions would be great or help!You can't inject SP1 using offline updates. You need to start with media provided by Microsoft that already has SP1 included and that will address your issues. You can easily download this from your MVLS site.
Jason | http://blog.configmgrftw.com -
SCCM 2012 SP1 Secondary Site installation Fails
Hi.
I have multiple secondary sites when i am trying to install new SCCM 2012 Secondary site server remotely but installation status shows a pending from last few days.
1) SEC server have privilages on System managent container
2) Primary site Server account and computer have local admin right on SEC server
hman logs says the following error message
Cannot get SQL Certificate from site xxx
CheckParentSQLServerCertificate: Failed to get SQL certificate for site XXX
1) Deleted the secondary site and reinstalled the site with different Site code but no luck
2) Able to telnet 1433 and 4022 from both primary to secondary and vice versa
3) SQL server Configuration Manager , TCP IP port was set to 1433.
please let me know if any thing i am missing
ThanksHi Guys
Exact same problem as described above:
Been told to install SQL Express manually first, but even after that, we continued to get the same problem.
The SQL Communication between the 2 sites doesn't seem to work.
I noticed that the Primary's SQL Security Account doesn't get created on Primary DB, in the Database replication the link has not yet been created either.
The "Exec spDrsSendSubscriptionInvalid 'Secondary 3 digit site code','Primary 3 digit site code','configuration data'" worked on 1 Secondary, but fails on all the rest.
Uninstalling/Installing the Secondary doesn't work either.
HMAN.LOG:
Update site server active directory informtion into DB SMS_HIERARCHY_MANAGER 2013/07/28 09:51:12 AM 7964 (0x1F1C)
CheckSQLServiceRestart : SQL Service hasn't been restart since last time we check, skip it. SMS_HIERARCHY_MANAGER 2013/07/28 09:51:12 AM 7964 (0x1F1C)
Time to verify if the parent['PRI-SITECODE'] sql server certificate is still valid on site ['SEC-SITECODE'] sql server. SMS_HIERARCHY_MANAGER 2013/07/28 09:51:12 AM 7964 (0x1F1C)
Cannot get SQL Certificate from Site 'PRI-SITECODE'. SMS_HIERARCHY_MANAGER 2013/07/28 09:51:12 AM 7964 (0x1F1C)
CheckParentSQLServerCertificate: Failed to get SQL certificate for site PM2 SMS_HIERARCHY_MANAGER 2013/07/28 09:51:12 AM 7964 (0x1F1C)
Any ideas would be appreciated. -
Upgrade from SCCM 2012 SP1 CU4 to R2 Fails - Unsupported Upgrade Path
Hi everybody,
I'm currently upgrading our SCCM infrastructure to SCCM 2012 R2 after have finished with the upgrade from SCCM 2012 RTM to SP1 CU4, thus far everything works fine, but when I try to update any
of the site servers, whether CAS or Primary, I'm getting the following error message in the Prerequisites Check:
I've gone through the system requirements and prerequisites over and over again and I can assure you that every possible update, supported OS, feature set, SQL Server, check list, etc,
etc, have been followed as per the official documentation available, however I'm stuck in this point, and surely enough I haven't been able to find out a similar case.Additionally I'm adding
the ConfigMgrPrereq log (the relevant portion of it) in case someone could kindly take a look at it.
<04-25-2014 02:06:46> ******* Start Prerequisite checking. *******
<04-25-2014 02:06:47> ********************************************
<04-25-2014 02:07:00> INFO: Detected current installed build version [7711] for sitecode [BRA]. For Upgrade,
minimum supported installed build version is [7804].
<04-25-2014 02:07:00> INFPROSCCMCMS.usersad.everis.int;
Unsupported upgrade path; Error;
Configuration Manager has detected that one or more sites in the hierarchy are installed with a version of Configuration Manager that is not supported for upgrade.
<04-25-2014 02:07:00> INFO: This rule only apply to primary site, skip checking.
<04-25-2014 02:07:00> INFPROSCCMCMS.usersad.everis.int;
Active Replica MP; Passed
<04-25-2014 02:07:00> INFO: This rule only applies to primary or secondary site in hierarchy, skip checking.
<04-25-2014 02:07:00> INFPROSCCMCMS.usersad.everis.int;
Parent site replication status; Passed
<04-25-2014 02:07:00> <<<RuleCategory: Database Upgrade Requirements>>>
<04-25-2014 02:07:00> <<<CategoryDesc: Checking the target ConfigMgr database is ready to upgrade...>>>
<04-25-2014 02:07:00> ===== INFO: Prerequisite Type & Server: SQL:INFPROSCCMCDB.usersad.everis.int
=====
<04-25-2014 02:07:00> <<<RuleCategory: Access Permissions>>>
<04-25-2014 02:07:00> <<<CategoryDesc: Checking access permissions...>>>
<04-25-2014 02:07:00> INFPROSCCMCDB.usersad.everis.int;
SQL Server sysadmin rights; Passed
<04-25-2014 02:07:00> INFPROSCCMCDB.usersad.everis.int; SQL Server sysadmin rights
for reference site; Passed
<04-25-2014 02:07:00> INFO: CheckLocalSys is Admin of <INFPROSCCMCDB.usersad.everis.int>.
<04-25-2014 02:07:09> INFPROSCCMCDB.usersad.everis.int;
Site server computer account administrative rights; Passed
<04-25-2014 02:07:09> INFPROSCCMCDB.usersad.everis.int;
SQL Server security mode; Passed
<04-25-2014 02:07:09> <<<RuleCategory: System Requirements>>>
<04-25-2014 02:07:09> <<<CategoryDesc: Checking system requirements for ConfigMgr...>>>
<04-25-2014 02:07:09> INFO: OS version:601, ServicePack:1.
<04-25-2014 02:07:09> INFO: Target computer is a Windows server.
<04-25-2014 02:07:09> INFPROSCCMCDB.usersad.everis.int;
Unsupported site server operating system version for Setup; Passed
<04-25-2014 02:07:09> INFPROSCCMCDB.usersad.everis.int;
Domain membership; Passed
<04-25-2014 02:07:09> INFPROSCCMCDB.usersad.everis.int;
Pending system restart; Passed
<04-25-2014 02:07:09> <<<RuleCategory: Dependent Components>>>
<04-25-2014 02:07:09> <<<CategoryDesc: Checking dependent components for ConfigMgr...>>>
<04-25-2014 02:07:09> INFO: Return code:0, Major:10, Minor:50, BuildNum:4000
<04-25-2014 02:07:09> INFPROSCCMCDB.usersad.everis.int;
SQL Server version; Passed
<04-25-2014 02:07:09> INFO: Get Sql edition:Enterprise Edition.
<04-25-2014 02:07:09> INFPROSCCMCDB.usersad.everis.int;
SQL Server Edition; Passed
<04-25-2014 02:07:09> INFO: Checking Tcp is enabled to Static port, SQL Server:INFPROSCCMCDB.usersad.everis.int,
Instance:.
<04-25-2014 02:07:09> INFPROSCCMCDB.usersad.everis.int;
SQL Server Tcp Port; Passed
<04-25-2014 02:07:09> INFO: Checking if SQL Server memory is limited.
<04-25-2014 02:07:09> INFO: SQL Server memory is limited.
<04-25-2014 02:07:09> INFPROSCCMCDB.usersad.everis.int;
Configuration for SQL Server memory usage; Passed
<04-25-2014 02:07:09> INFO: Checking if SQL Server memory is configured to reserve minimum memory.
<04-25-2014 02:07:09> INFO: Installing the central administration site or primary site, requires SQL
Server to reserve a minimum of 8 gigabytes (GB) of memory.
<04-25-2014 02:07:09> WARN: SQL Server minimum memory is 8000 MB.
<04-25-2014 02:07:09> INFPROSCCMCDB.usersad.everis.int; SQL Server process memory allocation;
Warning; Configuration Manager requires SQL Server to reserve a minimum of 8 gigabytes (GB) of memory for the central administration site and primary site and a minimum of 4 gigabytes (GB) for the secondary site. This memory is reserved by
using the Minimum server memory setting under Server Memory Options and is configured by using SQL Server Management Studio. For more information about how to set a fixed amount of memory, see
http://go.microsoft.com/fwlink/p/?LinkId=233759.
<04-25-2014 02:07:09> INFPROSCCMCDB.usersad.everis.int;
Case-insensitive collation on SQL Server; Passed
<04-25-2014 02:07:09> INFO: Check Machine FQDN: <INFPROSCCMCDB.usersad.everis.int>.
<04-25-2014 02:07:09> INFO: getaddrinfo returned success.
<04-25-2014 02:07:09> INFPROSCCMCDB.usersad.everis.int;
Validate FQDN of SQL Server Computer; Passed
<04-25-2014 02:07:09> INFO:CheckSupportedFQDNFormat <INFPROSCCMCDB.usersad.everis.int>
<04-25-2014 02:07:09> INFO: NetBIOS <INFPROSCCMCDB>
<04-25-2014 02:07:09> INFPROSCCMCDB.usersad.everis.int;
Primary FQDN; Passed
<04-25-2014 02:07:09> <<<RuleCategory: Site Upgrade Requirements>>>
<04-25-2014 02:07:09> <<<CategoryDesc: Checking if the target ConfigMgr site is ready to upgrade...>>>
<04-25-2014 02:07:09> <<<RuleCategory: Database Upgrade Requirements>>>
<04-25-2014 02:07:09> <<<CategoryDesc: Checking the target ConfigMgr database is ready to upgrade...>>>
<04-25-2014 02:07:09> ===== INFO: Prerequisite Type & Server: SDK:INFPROSCCMCMS.usersad.everis.int
=====
<04-25-2014 02:07:09> <<<RuleCategory: Access Permissions>>>
<04-25-2014 02:07:09> <<<CategoryDesc: Checking access permissions...>>>
<04-25-2014 02:07:09> INFO: The rule 'Administrative rights on site system' has been run on server 'INFPROSCCMCMS.usersad.everis.int',
skipped.
<04-25-2014 02:07:09> <<<RuleCategory: System Requirements>>>
<04-25-2014 02:07:09> <<<CategoryDesc: Checking system requirements for ConfigMgr...>>>
<04-25-2014 02:07:09> INFO: The rule 'Unsupported site server operating system version for Setup' has
been run on server 'INFPROSCCMCMS.usersad.everis.int', skipped.
<04-25-2014 02:07:09> INFO: The rule 'Domain membership' has been run on server 'INFPROSCCMCMS.usersad.everis.int',
skipped.
<04-25-2014 02:07:09> INFO: Windows Cluster not found on INFPROSCCMCMS.usersad.everis.int.
<04-25-2014 02:07:10> INFPROSCCMCMS.usersad.everis.int;
Windows Failover Cluster; Passed
<04-25-2014 02:07:10> INFO: The rule 'Pending system restart' has been run on server 'INFPROSCCMCMS.usersad.everis.int',
skipped.
<04-25-2014 02:07:10> <<<RuleCategory: Dependent Components>>>
<04-25-2014 02:07:10> <<<CategoryDesc: Checking dependent components for ConfigMgr...>>>
<04-25-2014 02:07:10> INFPROSCCMCMS.usersad.everis.int;
Windows Deployment Tools installed; Passed
<04-25-2014 02:07:10> INFO: CheckAdkWinPeInstalled on INFPROSCCMCMS.usersad.everis.int.
<04-25-2014 02:07:10> INFPROSCCMCMS.usersad.everis.int; Windows Preinstallation Environment
installed; Passed
<04-25-2014 02:07:10> INFPROSCCMCMS.usersad.everis.int;
SMS Provider machine has same domain as site server; Passed
<04-25-2014 02:07:10> <<<RuleCategory: Site Upgrade Requirements>>>
<04-25-2014 02:07:10> <<<CategoryDesc: Checking if the target ConfigMgr site is ready to upgrade...>>>
<04-25-2014 02:07:10> <<<RuleCategory: Database Upgrade Requirements>>>
<04-25-2014 02:07:10> <<<CategoryDesc: Checking the target ConfigMgr database is ready to upgrade...>>>
<04-25-2014 02:07:10> ***************************************************
<04-25-2014 02:07:10> ******* Prerequisite checking is completed. *******
<04-25-2014 02:07:10> ******************************************<04-25-2014 02:07:10> INFO: Updating
Prerequisite checking result into the registry
<04-25-2014 02:07:10> INFO: Connecting to INFPROSCCMCMS.usersad.everis.int registry
<04-25-2014 02:07:10> INFO: Setting registry values
If you wonder whether it might be related to this error:
-2014 02:07:00> INFO: Detected current installed build version [7711] for sitecode [BRA]. For Upgrade, minimum supported installed build version is [7804].
I confirm that this one site is a secondary one that's attached to a primary site and this log is from the CAS server, I managed to tall it and delete it from that site, but still appears listed
on the CAS management console, any idea how to force the removal of a secondary site that's attached to a primary from the CAS site when it has been removed already from said primary?
I've already tried the
Preinst /DELSITE XXX command but it only works when the site to remove it's attached to the local site and certainly not from a CAS
Finally, the version, build number and everything is correct, no idea what could be the problem, does anybody know a way to bypass this or force the re-evaluation of this rules, I've got
the impression that it's being cached somehow.
Any help would be highly appreciated,
Thank you.
Marcelo Estrada MCP-MCTS-MCITP-MCSA-MCSEHello again everybody,
I've finally managed to fix this up, in the end I had to delete those entries manually from the database as Garry suggested. After this was done the upgrade has gone through as expected with no further ado and has finalized already, now moving on to the
primary sites.
If anybody out there is facing the same issue, what I did was to delete those "stubborn" records executing the following statements over the CAS database:
DELETE
FROMServerDataWHERESiteCode='XXX'
DELETE
FROMSC_SiteDefinitionWHERESiteCode='XXX'
And this is pretty much about it. I'd recommend to take a proper backup first though as best practice.
Thank you all anyways for your answers and comments,
Marcelo Estrada MCP-MCTS-MCITP-MCSA-MCSE -
SCCM 2012 SP1 OSD Multicast is failing 0x80004005
I am trying to get multicast to work on a DP. But when I kick off an OSD and get to one of the items that I have enabled multicasting (lets say the OS image) then I get the following in the smsts.log:
Failed to get MCS key (Code 0x80004005)
ClientRequestToMCS::DoRequest failed. error = (0x80004005)
Request to MCS 'MYSCCMSERVER.SCCM.LOCAL' failed with error (Code 0x80004005)
Multicast OpenSessionRequest failed (0x80004005)
Sending status message: SMS_OSDeployment_PackageDownloadMulticastStatusFail
And then it reverts to a normal HTTP download. Why is this failing?there's a thread here about issues with MCS key though this is 2007 maybe it will point you in a right direction
http://social.technet.microsoft.com/Forums/systemcenter/en-US/07c735c8-9ce9-43b9-8cf3-e7b897568ef3/sccm-multicast-mcs-signedserializedkey-is-empty
The issues I had with multicast came up when the target device was not on the same subnet and network hardware was blocking communication. -
SCCM 2012 SP1 WSUS/Software Update Point Synchronization error on CAS.
Hi All,
Good day to all you.
I would like to seek all your help on this issue that i have encountering.
My SCCM 2012 SP1 CAS are having a synchronization error in WSUS/Software update point. The CAS have intergrated WSUS role in it. The last good synchronization was on July 16, 2014. No error log found on WCM.log and WSUSctrl.log
Error:
Sync failed: UssNotFound: WebException: The request failed with HTTP status 404: Not Found.~~at System.Web.Services.Protocols.SoapHttpClientProtocol.ReadResponse(SoapClientMessage message, WebResponse response, Stream responseStream, Boolean asyncCall).
Source: Microsoft.SystemsManagementServer.SoftwareUpdatesManagement.WsusSyncAction.WSyncAction.SyncWSUS
SMS_WSUS_SYNC_MANAGER 7/22/2014 3:05:32 PM 5776 (0x1690)
STATMSG: ID=6703 SEV=E LEV=M SOURCE="SMS Server" COMP="SMS_WSUS_SYNC_MANAGER" SYS=MYHQKUL990707S.sdb.com SITE=C01 PID=6948 TID=5776 GMTDATE=Tue Jul 22 07:05:32.796 2014 ISTR0="Microsoft.SystemsManagementServer.SoftwareUpdatesManagement.WsusSyncAction.WSyncAction.SyncWSUS"
ISTR1="UssNotFound: WebException: The request failed with HTTP status 404: Not Found.~~at System.Web.Services.Protocols.SoapHttpClientProtocol.ReadResponse(SoapClientMessage message, WebResponse response, Stream responseStream, Boolean asyncCall)"
ISTR2="" ISTR3="" ISTR4="" ISTR5="" ISTR6="" ISTR7="" ISTR8="" ISTR9="" NUMATTRS=0
SMS_WSUS_SYNC_MANAGER 7/22/2014 3:05:32 PM 5776 (0x1690)
Sync failed. Will retry in 60 minutes
SMS_WSUS_SYNC_MANAGER 5776 (0x1690)
below are wsyncmgr.log:
Setting sync alert to active state on site C01 SMS_WSUS_SYNC_MANAGER (0x1690)
Sync time: 0d00h01m14s SMS_WSUS_SYNC_MANAGER
5776 (0x1690)
Wakeup for a polling cycle SMS_WSUS_SYNC_MANAGER
5776 (0x1690)
Starting Sync SMS_WSUS_SYNC_MANAGER
5776 (0x1690)
Performing sync on retry schedule SMS_WSUS_SYNC_MANAGER
5776 (0x1690)
Read SUPs from SCF for MYHQKUL990707S.sdb.com SMS_WSUS_SYNC_MANAGER 5776 (0x1690)
Found 1 SUPs SMS_WSUS_SYNC_MANAGER
5776 (0x1690)
Found active SUP MYHQKUL990707S.sdb.com from SCF File.
SMS_WSUS_SYNC_MANAGER 5776 (0x1690)
STATMSG: ID=6701 SEV=I LEV=M SOURCE="SMS Server" COMP="SMS_WSUS_SYNC_MANAGER" SYS=MYHQKUL990707S.sdb.com SITE=C01 PID=6948 TID=5776 GMTDATE=Tue Jul 22 07:04:20.750 2014 ISTR0="" ISTR1="" ISTR2="" ISTR3=""
ISTR4="" ISTR5="" ISTR6="" ISTR7="" ISTR8="" ISTR9="" NUMATTRS=0
SMS_WSUS_SYNC_MANAGER 7/22/2014 3:04:20 PM
5776 (0x1690)
Synchronizing WSUS server MYHQKUL990707S.sdb.com SMS_WSUS_SYNC_MANAGER 5776 (0x1690)
STATMSG: ID=6704 SEV=I LEV=M SOURCE="SMS Server" COMP="SMS_WSUS_SYNC_MANAGER" SYS=MYHQKUL990707S.sdb.com SITE=C01 PID=6948 TID=5776 GMTDATE=Tue Jul 22 07:04:21.763 2014 ISTR0="" ISTR1="" ISTR2="" ISTR3=""
ISTR4="" ISTR5="" ISTR6="" ISTR7="" ISTR8="" ISTR9="" NUMATTRS=0
SMS_WSUS_SYNC_MANAGER 7/22/2014 3:04:21 PM
5776 (0x1690)
Using account sdb\SCCM-Admin to connect to WSUS Server
SMS_WSUS_SYNC_MANAGER 5776 (0x1690)
Synchronizing WSUS server myhqkul990707s.sdb.com ...
SMS_WSUS_SYNC_MANAGER 440 (0x01B8)
sync: Starting WSUS synchronization SMS_WSUS_SYNC_MANAGER
440 (0x01B8)
Sync failed: UssNotFound: WebException: The request failed with HTTP status 404: Not Found.~~at System.Web.Services.Protocols.SoapHttpClientProtocol.ReadResponse(SoapClientMessage message, WebResponse response, Stream responseStream, Boolean asyncCall). Source:
Microsoft.SystemsManagementServer.SoftwareUpdatesManagement.WsusSyncAction.WSyncAction.SyncWSUS
SMS_WSUS_SYNC_MANAGER 7/22/2014 3:05:32 PM
5776 (0x1690)
STATMSG: ID=6703 SEV=E LEV=M SOURCE="SMS Server" COMP="SMS_WSUS_SYNC_MANAGER" SYS=MYHQKUL990707S.sdb.com SITE=C01 PID=6948 TID=5776 GMTDATE=Tue Jul 22 07:05:32.796 2014 ISTR0="Microsoft.SystemsManagementServer.SoftwareUpdatesManagement.WsusSyncAction.WSyncAction.SyncWSUS"
ISTR1="UssNotFound: WebException: The request failed with HTTP status 404: Not Found.~~at System.Web.Services.Protocols.SoapHttpClientProtocol.ReadResponse(SoapClientMessage message, WebResponse response, Stream responseStream, Boolean asyncCall)"
ISTR2="" ISTR3="" ISTR4="" ISTR5="" ISTR6="" ISTR7="" ISTR8="" ISTR9="" NUMATTRS=0
SMS_WSUS_SYNC_MANAGER 7/22/2014 3:05:32 PM
5776 (0x1690)
Sync failed. Will retry in 60 minutes SMS_WSUS_SYNC_MANAGER
5776 (0x1690)
All response is much appreciated
Thank YouHi,
I recommend you look at the IIS log. Maybe it can give us some clues.
We
are trying to better understand customer views on social support experience, so your participation in this
interview project would be greatly appreciated if you have time.
Thanks for helping make community forums a great place. -
Need to make collection Query statement by sccm 2012 sp1 for Count of Licenses by License Status
I want to make collection Query statement by sccm 2012 sp1 for all windows activated and all non-activated windows.
Ahmed SherifHave a look at the Software Licensing Product attribute classes when creating a Query - remember to choose
System Ressource when creating the Query. You would have to enable this class to be collected during Hardware Inventory. Go to
Client Settings -> Hardware Inventory ->
Set Classes -> Select Software Licensing Product.
This Class is part of the Asset Intelligence classes so you could enable it from there as well.
Another way to accomplish is to use Compliance Settings to get this information.
Create a Configuration item that query the Win32_WindowsProductActivation WMI Class, if you are using XP and the
SoftwareLicensingProduct class for later os´s
Add this Configuration Item to a Baseline ad deploy it to your Collections as needed.
When the Baseline has been evaluated you can use this information to create query
Machines reported as compliant is actived and machines reported as Non-Compliant is not activated.
You can read about the Win32_WindowsProductActivation WMI Class here:
http://msdn.microsoft.com/en-us/library/aa394520(v=vs.85).aspx
and the SoftwareLicensingProduct here:
http://msdn.microsoft.com/en-us/library/cc534596(v=vs.85).aspx -
SCCM 2012 SP1 - Build and Capture - ReCapture impossible
Hi all
i upgrade my SCCM 2012 RTM to SCCM 2012 SP1 yesterday. Today i started a recapture of my Windows 7 and Windows 2008 R2 Base Image.
For that i have 2 VMs located in different SCCM Collections. And a Build and Capture Task Sequence is deployed to the collections.
Before SP1 the behavior was:
- Reset Required PXE Deployment in SCCM for the VMs
- Start VM
- VM boots with PXE
- VM installs and capture the Installation
And that i could do all the time so often as i want.
Now with SP1 it is the same procedure but just for one time. After one success Build and Capture Task, the vm is unable to do the task sequence again. The VM is booting into the PXE and then i can see in the smsts log:
There are no task sequences available to this computer
But there are. The Task Sequence is set to "Always rerun".
The only "fix" is to completely recreate the computer item in sccm.
What is here wrong? Is this a known bug?
best
JBABHi, your problem is that when you deploy the task over the collation you only specified "media and PXE" was available to and probably the machines that you try to capture already had the sccm client. You can try to deploy the sequence task to a collation
including the the option "configuration manager, media and PXE", or you can also deploy the task sequence to de "unknown devices" collation and delete the objects of the two virtual machines in configuration manager -
Reporting services keep failing on SCCM 2012 SP1
I have SCCM 2012 SP1 install with SSRS 2012 install on same server 2008 R2 server.
Reporting services keep failing with the following message when trying to START the service from the Reporting Services Configuration Manager Console
System.ServiceProcess.TimeoutException: Time out has expired and the operation has not been completed.
at System.ServiceProcess.ServiceController.WaitForStatus(ServiceControllerStatus desiredStatus, TimeSpan timeout)
at ReportServicesConfigUI.Panels.ServerInformationPanel.StartStopServiceTask(Boolean start)
Thx,
Joe
Thx, JoeGood advice Garth, but I have opened over 5 cases to try to resolve this and several other issues with my troublesome SCOM 2012 SP1 upgrade. That is why I am also sending it to the community in hope they can provide assistance.
CSS will only work on one specific issue and in most cases these are targeted bandaid fixes that DO NOT address the underlying or related issues. I a left to opening many tickets and still floundering with a unreliable product.
It seems to only be with System Center. All other products by Microsoft seem to be reliable and predicable and are easily supported using break fix support model of the current MS teams.
It is SQL (SSRS) that controls subscriptions not CM12. CM12 only leverages the APIs provided by SQL (SSRS).
I hate to say this but Why do you think this problem has anything to do with CM12?
If CSS tell you to re-create the subscription and the problem re-occurs then I would re-open the ticket and tell them that the problem is NOT fixed and to continue working on it.
Garth Jones | My blogs: Enhansoft and
Old Blog site | Twitter:
@GarthMJ -
Management Point fails after installing SCCM 2012 SP1
I'm carrying out an install of SCCM 2012 SP1 with the following hardware (fresh install not an upgrade from 2007)
1. Newly built Windows Server 2012 box
2. Site database located on a remote SQL 2012 cluster, both nodes Windows Server 2012, with CU5
The install went fine but when checking the Site Server Components the Management Point isn't installing. The following both show errors;
SMS_MP_CONTROL_MANAGER - MP.msi could not install. Checked the MP.msi log file which shows the following errors;
[19:53:18] Failed to compile 'C:\Program Files\SMS_CCM\CcmExec_Global.mof' (Phase: 3, Object: 5, Lines: 76 - 83, Error: 80041002)
[19:53:18] Failed to compile 'C:\Program Files\SMS_CCM\PolicyDefaults.mof' (Phase: 3, Object: 4, Lines: 49 - 57, Error: 80041002)
[19:53:18] Failed to compile 'C:\Program Files\SMS_CCM\StateMsgSchema.mof' (Phase: 3, Object: 6, Lines: 89 - 94, Error: 80041002)
[19:53:18] Failed to compile 'C:\Program Files\SMS_CCM\DataTransferService.mof' (Phase: 3, Object: 5, Lines: 318 - 323, Error: 80041002)
[19:53:19] Failed to compile 'C:\Program Files\SMS_CCM\CcmExec_MP.mof' (Phase: 3, Object: 1, Lines: 31 - 36, Error: 80041002)
MSI (s) (0C!94) [19:53:20:862]: Product: ConfigMgr Management Point -- Error 25140. Setup was unable to compile the file CcmExec_Global.mof
The error code is 80041002
Error 25140. Setup was unable to compile the file CcmExec_Global.mof
The error code is 80041002
CustomAction CcmRegisterWmiMofFile returned actual error code 1603 (note this may not be 100% accurate if translation happened inside sandbox)
SMS_NOTIFICATION_SERVER - bgbisapi.msi could not install. Extract from log below;
[19:53:38] IGNORE: Failed to delete extension 'C:\Program Files\SMS_CCM\bgbisapi.dll'. Return Code = 0x80020009 (The extension might not be registered)
[19:53:39] WARNING: Failed to remove PerfLib entries for performance application SmsBgb (2)
[19:53:39] WARNING: Failed to remove configuration for performance application SmsBgb (80070057)
MSI (s) (0C!80) [19:53:39:540]: Product: BGB http proxy -- Internal Error 25001. 80070057
Internal Error 25001. 80070057
CustomAction CcmRegisterPerfCounters returned actual error code 1603 (note this may not be 100% accurate if translation happened inside sandbox)
I've tried uninstalling MP and reinstalling, triple checked all the right pre-reqs in Roles and Features are enabled, even rebuilt the server from scratch and tried again but same result.
Would really appreciate some help if anyone's fixed this issueI'm still struggling, I've uninstalled MP
<04/16/14 08:06:59> SMSMP Setup Started....
<04/16/14 08:06:59> Parameters: D:\Program Files\Microsoft Configuration Manager\bin\x64\rolesetup.exe /deinstall /siteserver:EICSC001 SMSMP 0
<04/16/14 08:06:59> Deinstalling the SMSMP
<04/16/14 08:06:59> No versions of SMSMP are installed. Returning Success.
<04/16/14 08:06:59> ~RoleSetup().
Ran the command, Invoke-Command {gwmi -query "SELECT * FROM __Namespace WHERE Name='CCM'" -Namespace "root" | Remove-WmiObject}
Checked Namespace Instances to ensure '= ccm' is not longer there.
Rebooted Server and re-installed MP but it still fails
<04/16/14 08:37:26> ====================================================================
<04/16/14 08:37:26> SMSMP Setup Started....
<04/16/14 08:37:26> Parameters: D:\Program Files\Microsoft Configuration Manager\bin\x64\rolesetup.exe /install /siteserver:EICSC001 SMSMP 0
<04/16/14 08:37:26> Installing Pre Reqs for SMSMP
<04/16/14 08:37:26> ======== Installing Pre Reqs for Role SMSMP ========
<04/16/14 08:37:26> Found 2 Pre Reqs for Role SMSMP
<04/16/14 08:37:26> Pre Req MSXML60 found.
<04/16/14 08:37:26> No versions of MSXML60 are installed. Would install new MSXML60.
<04/16/14 08:37:26> Enabling MSI logging. msxml6_x64.msi will log to D:\Program Files\Microsoft Configuration Manager\logs\msxml6_x64MSI.log
<04/16/14 08:37:26> Installing D:\Program Files\Microsoft Configuration Manager\bin\x64\00000409\msxml6_x64.msi
<04/16/14 08:37:26> msxml6_x64.msi exited with return code: 0
<04/16/14 08:37:26> msxml6_x64.msi Installation was successful.
<04/16/14 08:37:26> Pre Req SqlNativeClient found.
<04/16/14 08:37:26> SqlNativeClient already installed (Product Code: {D411E9C9-CE62-4DBF-9D92-4CB22B750ED5}). Would not install again.
<04/16/14 08:37:26> Pre Req SqlNativeClient is already installed. Skipping it.
<04/16/14 08:37:26> ======== Completed Installation of Pre Reqs for Role SMSMP ========
<04/16/14 08:37:26> Installing the SMSMP
<04/16/14 08:37:26> Passed OS version check.
<04/16/14 08:37:26> IIS Service is installed.
<04/16/14 08:37:26> No versions of SMSMP are installed. Installing new SMSMP.
<04/16/14 08:37:26> Enabling MSI logging. mp.msi will log to D:\Program Files\Microsoft Configuration Manager\logs\mpMSI.log
<04/16/14 08:37:26> Installing D:\Program Files\Microsoft Configuration Manager\bin\x64\mp.msi CCMINSTALLDIR="D:\Program Files\SMS_CCM" CCMSERVERDATAROOT="D:\Program Files\Microsoft Configuration Manager" USESMSPORTS=TRUE SMSPORTS=80 USESMSSSLPORTS=TRUE
SMSSSLPORTS=443 USESMSSSL=TRUE SMSSSLSTATE=0 CCMENABLELOGGING=TRUE CCMLOGLEVEL=1 CCMLOGMAXSIZE=1000000 CCMLOGMAXHISTORY=1
<04/16/14 08:37:26> mp.msi exited with return code: 1603
<04/16/14 08:37:26> Backing up D:\Program Files\Microsoft Configuration Manager\logs\mpMSI.log to D:\Program Files\Microsoft Configuration Manager\logs\mpMSI.log.LastError
<04/16/14 08:37:26> Fatal MSI Error - mp.msi could not be installed.
<04/16/14 08:37:26> ~RoleSetup().
On checking I don't seem to have anything in IIS, no default web site.
I've tried reinstalling IIS and reinstalling SCCM 2012 but what ever I do I still hit the same issue with the Management Point.
Any assistance would be greatly appreciated.
Thanks -
Dear Brothers,
I have an issue with two (2) of my Site Servers, I have below scenarioa and explained issue details:
Scenario:
1. Server1: Windows 2012 Server, CAS, SCCM 2012 Hierarchy Roles: Management Point, DP, SUP, Component Server.
2. Server2: Windows 2008 R2 Server, Secondary Site Role, SCCM 2012 Hierarchy Roles: Management Point, DP, Component Server.
Issue:
After updating the SCCM 2012 Client to CU4 on the actual Site Server, the "ccmsetup" appears also with "SMS Agent Host"
at the Service MMC. Which I believed this is very unusual behavior.
The Client however it seems properly installed and working please see below details:
Questions: I believed the Client installations are still running on the background, even though the Client tends to look working on the Control Panel.
1. How can I resolved this issue?
2. Should I need to perform a total Client uninstallation, even depth till removing entries in the Registry levels?
3. Or this is a normal behavior for the scenario?
Advance thanks for your future replies, my brothers in technology.Dear Brother,
2 Weeks since I installed the CU4, it seems a little bit to long isn't it? for both the ccmsetup and the SMS Host Agent Services to exist, for the errors on the ccmsetup.log there are some errors after uninstallation since I am trying to removed
the issue .
CCMsetup.log
==========[ ccmsetup started in process 5376 ]========== 7/1/2014 7:14:45 PM 4104 (0x1008)
Running on platform X64 7/1/2014 7:14:45 PM 4104 (0x1008)
Updated security on object C:\Windows\ccmsetup\cache\. 7/1/2014 7:14:45 PM 4104 (0x1008)
Launch from folder C:\Windows\ccmsetup\ 7/1/2014 7:14:45 PM 4104 (0x1008)
CcmSetup version: 5.0.7804.1500 7/1/2014 7:14:45 PM 4104 (0x1008)
Running on OS (6.2.9200). Service Pack (0.0). SuiteMask = 272. Product Type = 3 7/1/2014 7:14:45 PM 4104 (0x1008)
Ccmsetup command line: ccmsetup.exe /uninstall 7/1/2014 7:14:45 PM 4104 (0x1008)
Command line parameters for ccmsetup have been specified. No registry lookup for command line parameters is required. 7/1/2014 7:14:45 PM 4104 (0x1008)
Command line: ccmsetup.exe /uninstall 7/1/2014 7:14:45 PM 4104 (0x1008)
SslState value: 224 7/1/2014 7:14:45 PM 4104 (0x1008)
Detected client version 5.00.7804.1500 from WMI. 7/1/2014 7:14:45 PM 4104 (0x1008)
Updated security on object C:\Windows\ccmsetup\. 7/1/2014 7:14:45 PM 4104 (0x1008)
Another instance of ccmsetup is already running. 7/1/2014 7:14:45 PM 4104 (0x1008)
Task 'Configuration Manager Client Upgrade Task' does not exist 7/1/2014 7:14:45 PM 4104 (0x1008)
CcmSetup is exiting with return code 3 7/1/2014 7:14:45 PM 4104 (0x1008)
MSI: Action 19:15:20: SmsRemoveUIEvents. This custom action is no longer used. The custom action used to remove the COM+ event subscriber and publisher used for UI notifications. We no longer use COM+ events for UI notifications. 7/1/2014 7:15:20 PM 5628
(0x15FC)
MSI: Action 19:15:20: CcmUnregisterPerfCounters. Removes performance counters gathered in the CcmUnregisterPerfCountersInit action 7/1/2014 7:15:20 PM 5628 (0x15FC)
MSI: Action 19:15:20: CcmRemoveLanternDocuments. Removing documents from Microsoft Policy Platform that have been submitted by Configuration Manager authority. 7/1/2014 7:15:20 PM 5628 (0x15FC)
MSI: Action 19:15:30: CcmTypelibRollback. In the event of install failing, this event rolls back the type libraries to the state before install started. 7/1/2014 7:15:30 PM 5628 (0x15FC)
MSI: Action 19:15:30: SmsDeinstallDesktopClient. This custom action uninstalls the desktop client with following steps-
1. Makes sure there are no desktop client installations in progress and prevents any new instance of intallation.
2. Checks the desktop client version and gets the installation direcotry.
3. Stops remote control and other desktop components.
4. Kills the following client processes - clisvc1.exe, pea32.exe, smsapm32.exe, smsmon32.exe and sms_reen.exe.
5. Saves information needed for migration and uninstalls the desktop components followed by clean up. 7/1/2014 7:15:30 PM 5628 (0x15FC)
MSI: Action 19:15:30: CcmDetectFilesInUseRollback. Rolls back files moved by CcmDetectFilesInUse. 7/1/2014 7:15:30 PM 5628 (0x15FC)
MSI: Action 19:15:30: CcmDetectFilesInUse. Moves files that are in use so that they will be deleted upon the next reboot. 7/1/2014 7:15:30 PM 5628 (0x15FC)
MSI: Action 19:15:31: CcmDetectFilesInUseCommit. Commits action of CcmDetectFileInUse. After this we cannot rollback. 7/1/2014 7:15:31 PM 5628 (0x15FC)
MSI: Action 19:15:31: InstallFiles. Copying new files 7/1/2014 7:15:31 PM 5628 (0x15FC)
MSI: Internal Error 2902. ixfAssemblyCopy 7/1/2014 7:15:32 PM 5628 (0x15FC)
MSI: Action 19:15:32: Rollback. Rolling back action: 7/1/2014 7:15:32 PM 5628 (0x15FC)
File C:\Windows\ccmsetup\configmgr2012ac-sp1-kb2882125-x64.msp installation failed. Error text: ExitCode: 1603
Action: InstallFiles.
ErrorMessages:
Internal Error 2902. ixfAssemblyCopy
7/1/2014 7:15:33 PM 5628 (0x15FC)
A Fallback Status Point has not been specified. Message with STATEID='301' will not be sent. 7/1/2014 7:15:33 PM 5628 (0x15FC)
Deleted file C:\Windows\ccmsetup\ccmsetup.xml 7/1/2014 7:15:33 PM 5628 (0x15FC)
Deleted file C:\Windows\ccmsetup\client.msi 7/1/2014 7:15:33 PM 5628 (0x15FC)
CcmSetup failed with error code 0x80070643 7/1/2014 7:15:33 PM 5628 (0x15FC)
Regards, -
SCCM 2012 SP1 and Exchange 2013 Connector Get-Recipient cmdlet failed
I have been trying to get my Exchange Connector working with SCCM 2012 SP1 for a week or so now. Every post tells me that the Get-Recipient cmdlet failed is a security permissions error. I have given the service account running the connector full Exchange
Server Management rights including Recipient Management and Organization View-Only. I have even tested remote power shell to the CAS server and run the cmdlet with no issues.
For some reason it just does not want to work for me. Has anyone been running into this issue?Now before you read the following error and say oh this is a permission issue I am telling you it is not. I have given the account full Exchange admin rights and I have even tested the Get-Recipient cmdlet remotely to the Exchange server and it works with
no issues. I have also noticed multiple forum posts with the exact same issues.
I have noticed one thing that stands outs "Cannot bind parameter 'Filter' to the target. Exception setting "Filter": "The value "$true" could not be converted to type System.Boolean"
I believe this issue may be related to changes in the powershell commands with Exchange 2013, but I do not know where or how to edit the ps1 script.
I am getting the error below:
ERROR: [MANAGED] Invoking cmdlet Get-Recipient failed. Exception: System.Management.Automation.RemoteException: Cannot bind parameter 'Filter' to the target. Exception setting "Filter": "The value "$true" could not be converted to
type System.Boolean."~~ at System.Management.Automation.PowerShell.CoreInvoke[TOutput](IEnumerable input, PSDataCollection`1 output, PSInvocationSettings settings)~~ at System.Management.Automation.PowerShell.Invoke(IEnumerable input, PSInvocationSettings
settings)~~ at System.Management.Automation.PowerShell.Invoke()~~ at Microsoft.ConfigurationManager.ExchangeConnector.Connector.Invoke(PSCommand cmd)
SMS_EXCHANGE_CONNECTOR 9/19/2013 12:00:01 AM
4200 (0x1068)
STATMSG: ID=8817 SEV=W LEV=M SOURCE="SMS Server" COMP="SMS_EXCHANGE_CONNECTOR" SYS=MySite SITE=MySiteID PID=xxx TID=xxx GMTDATE=Thu Sep 19 07:00:01.653 2013 ISTR0="Get-Recipient" ISTR1="ParameterBindingFailed,Microsoft.Exchange.Management.RecipientTasks.GetRecipient"
ISTR2="Cannot bind parameter 'Filter' to the target. Exception setting "Filter": "The value "$true" could not be converted to type System.Boolean."" ISTR3="" ISTR4="" ISTR5="" ISTR6=""
ISTR7="" ISTR8="" ISTR9="" NUMATTRS=0
SMS_EXCHANGE_CONNECTOR 9/19/2013 12:00:01 AM
4200 (0x1068)
ERROR: [MANAGED] Exception: Cannot bind parameter 'Filter' to the target. Exception setting "Filter": "The value "$true" could not be converted to type System.Boolean."
SMS_EXCHANGE_CONNECTOR 9/19/2013 12:00:01 AM
4200 (0x1068) -
WSUS SP2; SCCM 2012 SP1; Sync failed: WSUS update source not found
Hi,
I have installed the Fresh SCCM 2012 SP1 and WSUS 3.0 SP2 + KB2720211 + KB2734608. However, still the Sync is getting failed. This is what I am getting in the wsyncmgr and WCM logs:
wsyncmgr:
Sync failed: WSUS update source not found on site PR1. Please refer to WCM.log for configuration error details.. Source: getSiteUpdateSource
SMS_WSUS_SYNC_MANAGER 1/9/2015 12:00:00 PM
3668 (0x0E54)
STATMSG: ID=6703 SEV=E LEV=M SOURCE="SMS Server" COMP="SMS_WSUS_SYNC_MANAGER" SYS=ABC.XYZ.net SITE=PR1 PID=2724 TID=3668 GMTDATE=Fri Jan 09 18:00:00.537 2015 ISTR0="getSiteUpdateSource" ISTR1="WSUS update source not found
on site PR1. Please refer to WCM.log for configuration error details." ISTR2="" ISTR3="" ISTR4="" ISTR5="" ISTR6="" ISTR7="" ISTR8="" ISTR9="" NUMATTRS=0
SMS_WSUS_SYNC_MANAGER 1/9/2015 12:00:00 PM
3668 (0x0E54)
Sync failed. Will retry in 60 minutes SMS_WSUS_SYNC_MANAGER
1/9/2015 12:00:00 PM 3668 (0x0E54)
WCM:
Checking for supported version of WSUS (min WSUS 3.0 SP2 + KB2720211 + KB2734608)
SMS_WSUS_CONFIGURATION_MANAGER 1/9/2015 11:19:03 AM
4176 (0x1050)
Checking runtime v2.0.50727... SMS_WSUS_CONFIGURATION_MANAGER
1/9/2015 11:19:03 AM 4176 (0x1050)
Did not find supported version of assembly Microsoft.UpdateServices.Administration.
SMS_WSUS_CONFIGURATION_MANAGER 1/9/2015 11:19:03 AM
4176 (0x1050)
Checking runtime v4.0.30319... SMS_WSUS_CONFIGURATION_MANAGER
1/9/2015 11:19:03 AM 4176 (0x1050)
Did not find supported version of assembly Microsoft.UpdateServices.Administration.
SMS_WSUS_CONFIGURATION_MANAGER 1/9/2015 11:19:03 AM
4176 (0x1050)
Supported WSUS version not found SMS_WSUS_CONFIGURATION_MANAGER
1/9/2015 11:19:03 AM 4176 (0x1050)
STATMSG: ID=6607 SEV=E LEV=M SOURCE="SMS Server" COMP="SMS_WSUS_CONFIGURATION_MANAGER" SYS=ABC.XYZ.net SITE=PR1 PID=2724 TID=4176 GMTDATE=Fri Jan 09 17:19:03.489 2015 ISTR0="DEF.XYZ.net" ISTR1="" ISTR2="" ISTR3=""
ISTR4="" ISTR5="" ISTR6="" ISTR7="" ISTR8="" ISTR9="" NUMATTRS=0
SMS_WSUS_CONFIGURATION_MANAGER 1/9/2015 11:19:03 AM
4176 (0x1050)
Remote configuration failed on WSUS Server.
SMS_WSUS_CONFIGURATION_MANAGER 1/9/2015 11:19:03 AM
4176 (0x1050)
STATMSG: ID=6600 SEV=E LEV=M SOURCE="SMS Server" COMP="SMS_WSUS_CONFIGURATION_MANAGER" SYS=ABC.XYZ.net SITE=PR1 PID=2724 TID=4176 GMTDATE=Fri Jan 09 17:19:03.515 2015 ISTR0="DEF.XYZ.net" ISTR1="" ISTR2="" ISTR3=""
ISTR4="" ISTR5="" ISTR6="" ISTR7="" ISTR8="" ISTR9="" NUMATTRS=0
SMS_WSUS_CONFIGURATION_MANAGER 1/9/2015 11:19:03 AM
4176 (0x1050)
I have used the default port numbers 80 and 443 still the sync is failing. Please provide your advise to fix this issue.
Regards,
MalwinderWCM:
Checking for supported version of WSUS (min WSUS 3.0 SP2 + KB2720211 + KB2734608)
It's not only a matter of installing the console, but also those hotfixes on a remote server ...
Torsten Meringer | http://www.mssccmfaq.de
Maybe you are looking for
-
Pattern and Matcher of Regular Expressions
Hello All, MTMISRVLGLIRDQAISTTFGANAVTDAFWVAFRIPNFLRRLFAEGSFATAFVPVFTEVK ETRPHADLRELMARVSGTLGGMLLLITALGLIFTPQLAAVFSDGAATNPEKYGLLVDLLR LTFPFLLFVSLTALAGGALNSFQRFAIPALTPVILNLCMIAGALWLAPRLEVPILALGWA VLVAGALQLLFQLPALKGIDLLTLPRWGWNHPDVRKVLTLMIPTLFGSSIAQINLM
-
Newbie with "disk too slow" issues
Hi folks, TOTAL newbie (Mac newbie, audio newbie) here, up front disclaimer. I've just been trying to play the "Numbers Game" demo project in Logic Pro on my new MacBook Pro and I'm getting the "disk too slow" message (error 10010)...This is a 2.66 G
-
How do I install DNG Converter plugin? I downloaded the plugin. its on my desktop but when I double click on it, it says: The following disk images couldn't be opened / DNG Converter 7.2. dm invalid checksum. Any suggestion?
-
How do I start and stop the SolidWorks Simulation by Labview function?
Hi folks I have two question. 1. According to "NI SoftMotion for SolidWorks - FAQ http://zone.ni.com/devzone/cda/tut/p/id/10493#h49", an user can manually by right-clicking the SolidWorks assembly in the Project Explorer and select Start Simulation.
-
DVD drive not working with Windows?
Hi, I have a 20" Intel Core Duo iMac running Windows XP SP2 via Bootcamp. I tried burning a homemade DVD last night using several programs (Nero and DVD Shrink to be specific) and I was not able to choose the DVD drive as the target. When I open My C